Transcription Factor

Accessions: ETV5_DBD (HumanTF 1.0), ETV5_TF1 (HumanTF2 1.0)
Names: ETS translocation variant 5, Ets-related protein ERM, ETV5, ETV5_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HumanTF2 1.0 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Uniprot: P41161
Notes: Ensembl ID: ENSG00000171656; DNA-binding domain sequence; TF family: ETS; Clone source: Gene synthesis, Ensembl ID: ENSG00000171656; Construct type: TF1(SBP); TF family: ETS; Clone source: Jolma et al. 2013
Length: 128
Pfam Domains: 21-102 Ets-domain
Sequence:
(in bold interface residues)
1 KVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARR 60
61 WGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFL 120
121 KAESECHL
Interface Residues: 61, 73, 74, 76, 77, 78, 80, 81, 95
3D-footprint Homologues: 6sjf_B, 8smh_F, 3jtg_A, 8smj_F, 1dux_F, 7jsa_J, 3zp5_A, 4mhg_A, 8ee9_F, 4uno_A, 2stt_A, 4l18_B, 1bc8_C, 4lg0_B, 1yo5_C, 4iri_A, 1awc_A
Binding Motifs: ETV5_DBD acCGGAwgyr
ETV5_CEBPD rsCGGAwrTTGCGyAAy
ETV5_CLOCK rCACGTGkdggrsCGGAwgy
ETV5_DLX2 rsCGGAwrtvrsymATTA
ETV5_DRGX_1 rsmGGAAGyAATTA
ETV5_DRGX_2 TaAtkrsCGGAwGy
ETV5_EOMES_1 rrGTGtkrdbskgrgkTsrCrsmGGAwgy
ETV5_EOMES_2 ycrCrcCGGAwg
ETV5_ETV7 rvGGAmGGATgTCCkbg
ETV5_EVX1_1 rsCGGWAATkr-
ETV5_EVX1_2 rsCGGwAATgvbsaTtAr
ETV5_EVX1_2_3 rsmGGWAATgrgyvaTtAk
ETV5_FIGLA rgmGGAArCAGGTGg
ETV5_FOXI1_1 GtMAACMGGAwGy
ETV5_FOXI1_2 rsCGGAwGTkkw
ETV5_FOXI1_2_3 tGtkkmCGGAwGt
ETV5_FOXO1_1 rscGGATGtkkwb
ETV5_FOXO1_2 rtmAACAGGAwrt
ETV5_HES7_1 smGGAwgcssvgCrCGyG
ETV5_HES7_2 gsCrCGyGssbasmGGAwgk
ETV5_HOXA13 rmcGGAwGYcgTaaa
ETV5_HOXA2_1 rsCGGAwGTmATTA
ETV5_HOXA2_2 rscGGwAATgrstdwdsymaTtA
ETV5_HOXA2_2_3 rsCGGwArTkr-
ETV5_HOXB13 rsCGGAwGYmrTwAa
ETV5_TCF3_1 CAsGTGsrscGGAagkg
ETV5_TCF3_2 gscGGAwgkgggrCASsTGk
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.