Transcription Factor
Accessions: | ETV5_DBD (HumanTF 1.0), ETV5_TF1 (HumanTF2 1.0) |
Names: | ETS translocation variant 5, Ets-related protein ERM, ETV5, ETV5_HUMAN |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1, HumanTF2 1.0 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Uniprot: | P41161 |
Notes: | Ensembl ID: ENSG00000171656; DNA-binding domain sequence; TF family: ETS; Clone source: Gene synthesis, Ensembl ID: ENSG00000171656; Construct type: TF1(SBP); TF family: ETS; Clone source: Jolma et al. 2013 |
Length: | 128 |
Pfam Domains: | 21-102 Ets-domain |
Sequence: (in bold interface residues) | 1 KVKQEPTMYREGPPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARR 60 61 WGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFL 120 121 KAESECHL |
Interface Residues: | 61, 73, 74, 76, 77, 78, 80, 81, 95 |
3D-footprint Homologues: | 6sjf_B, 3zp5_A, 7jsa_J, 4mhg_A, 2stt_A, 8ee9_F, 4uno_A, 3jtg_A, 1dux_F, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A, 4iri_A, 1bc8_C, 4l18_B |
Binding Motifs: | ETV5_DBD acCGGAwgyr ETV5_CEBPD rsCGGAwrTTGCGyAAy ETV5_CLOCK rCACGTGkdggrsCGGAwgy ETV5_DLX2 rsCGGAwrtvrsymATTA ETV5_DRGX_1 rsmGGAAGyAATTA ETV5_DRGX_2 TaAtkrsCGGAwGy ETV5_EOMES_1 rrGTGtkrdbskgrgkTsrCrsmGGAwgy ETV5_EOMES_2 ycrCrcCGGAwg ETV5_ETV7 rvGGAmGGATgTCCkbg ETV5_EVX1_1 rsCGGWAATkr- ETV5_EVX1_2 rsCGGwAATgvbsaTtAr ETV5_EVX1_2_3 rsmGGWAATgrgyvaTtAk ETV5_FIGLA rgmGGAArCAGGTGg ETV5_FOXI1_1 GtMAACMGGAwGy ETV5_FOXI1_2 rsCGGAwGTkkw ETV5_FOXI1_2_3 tGtkkmCGGAwGt ETV5_FOXO1_1 rscGGATGtkkwb ETV5_FOXO1_2 rtmAACAGGAwrt ETV5_HES7_1 smGGAwgcssvgCrCGyG ETV5_HES7_2 gsCrCGyGssbasmGGAwgk ETV5_HOXA13 rmcGGAwGYcgTaaa ETV5_HOXA2_1 rsCGGAwGTmATTA ETV5_HOXA2_2 rscGGwAATgrstdwdsymaTtA ETV5_HOXA2_2_3 rsCGGwArTkr- ETV5_HOXB13 rsCGGAwGYmrTwAa ETV5_TCF3_1 CAsGTGsrscGGAagkg ETV5_TCF3_2 gscGGAwgkgggrCASsTGk |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Jolma A, Yin Y, Nitta KR, Dave K, Popov A, Taipale M, Enge M, Kivioja T, Morgunova E, Taipale J. DNA-dependent formation of transcription factor pairs alters their binding specificity. Nature 527:384-8 (2015). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.