Transcription Factor

Accessions: JDP2_DBD (HumanTF 1.0), JDP2 (HT-SELEX2 May2017)
Names: JDP2, JDP2_HUMAN, ENSG00000140044
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q8WYK2
Notes: Ensembl ID: ENSG00000140044; DNA-binding domain sequence; TF family: bZIP; Clone source: Megaman, TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 101
Pfam Domains: 20-78 bZIP transcription factor
21-74 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 HFLEVKLGKRPQPVKSELDEEEERRKRRREKNKVAAARCRNKKKERTEFLQRESERLELM 60
61 NAELKTQIEELKQERQQLILMLNRHRPTCIVRTDSVKTPES
Interface Residues: 28, 29, 32, 33, 35, 36, 39, 40, 43
3D-footprint Homologues: 4eot_A, 1skn_P, 7x5e_E, 2wt7_A, 7x5e_F, 2wt7_B, 8k8c_A, 6mg1_B, 5vpe_D, 5t01_B, 5vpe_C
Binding Motifs: JDP2_DBD_1 ATGAsTCAT
JDP2_DBD_2 gATGACGTCAyc
JDP2_3 srTGACGTCAys
JDP2_4 sATGAsTCATs
JDP2_7 srTgAyGTmAys
JDP2_8 srTGmskCAys
JDP2_methyl_1 grTGAyGTCAyc
JDP2_methyl_2 gATGAsTCAyc
JDP2_methyl_5 srTGAyGTcAys
JDP2_methyl_6 srTGAsTCAys
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.