Transcription Factor

						

			
Accessions: T008630_1.02 (CISBP 1.02)

			
Names: ANIA_01690, T008630_1.02;
Organisms: Emericella nidulans
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:AT hook
Length: 324
Pfam Domains:     47-58 AT hook motif
    69-77 AT hook motif
  101-110 AT hook motif
  130-288 EVE domain
Sequence: MALGRKRKSESVSVVEEAGEADTPSKRIATDATSTTSTPATPATGEKRGRGRPRKYPVGS
TPVRPDGPKRGRGRPRKETTGTATPKAKATPKSNTPGGVSRGRGRPRKNPIPSDSTPTAD
GNTANDSGRSYWLMKAEPESRIEKGKDVKFSIDDLRAAKEPEPWDGVRNPVARKNMQSMK
KGDLAFFYHSNCKVPGIAGVMEIVQEHSPDETAFDPSHPYYDEKSKRENPRWVVVHVEFR
RKFDKLITLNELKSHAGANAPLENLQMLKQGRLSVSAVSPQEWDFIMSLASNEAAFGPSK
ESKSYDANEPAKKDGGAEKTEATG
Binding Motifs: M0122_1.02 ccsrrhwww
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.