Transcription Factor
| Accessions: | T008630_1.02 (CISBP 1.02) |
| Names: | ANIA_01690, T008630_1.02; |
| Organisms: | Emericella nidulans |
| Libraries: | CISBP 1.02 1 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
| Notes: | experiment type:PBM, family:AT hook |
| Length: | 324 |
| Pfam Domains: | 47-58 AT hook motif 69-77 AT hook motif 101-110 AT hook motif 130-288 EVE domain |
| Sequence: | MALGRKRKSESVSVVEEAGEADTPSKRIATDATSTTSTPATPATGEKRGRGRPRKYPVGS TPVRPDGPKRGRGRPRKETTGTATPKAKATPKSNTPGGVSRGRGRPRKNPIPSDSTPTAD GNTANDSGRSYWLMKAEPESRIEKGKDVKFSIDDLRAAKEPEPWDGVRNPVARKNMQSMK KGDLAFFYHSNCKVPGIAGVMEIVQEHSPDETAFDPSHPYYDEKSKRENPRWVVVHVEFR RKFDKLITLNELKSHAGANAPLENLQMLKQGRLSVSAVSPQEWDFIMSLASNEAAFGPSK ESKSYDANEPAKKDGGAEKTEATG |
| Binding Motifs: | M0122_1.02 ccsrrhwww |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.