Transcription Factor

Accessions: 1o4x_B (3D-footprint 20231221), 6ht5_D (3D-footprint 20231221)
Names: SOX2_HUMAN, Transcription factor SOX-2, SOX2_MOUSE
Organisms: Homo sapiens, Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P48431
Length: 77
Pfam Domains: 2-63 Domain of unknown function (DUF1898)
3-71 HMG (high mobility group) box
Sequence:
(in bold interface residues)
1 DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLR 60
61 ALHMKEHPDYKYRPRRK
Interface Residues: 5, 8, 10, 11, 12, 14, 18, 22, 29, 30, 31, 34, 72, 76
3D-footprint Homologues: 3tmm_A, 4y60_C, 2gzk_A, 1j5n_A, 6jrp_D, 2lef_A, 3u2b_C, 1o4x_B, 7m5w_A, 3f27_D, 4s2q_D, 1qrv_A, 1hry_A, 3tq6_B, 1ckt_A, 7zie_A
Binding Motifs: 1o4x_AB CATTnGCATGACAAAG
1o4x_B gCAAAG
6ht5_DE CATTGTTATGC
Binding Sites: 1o4x_C
1o4x_D
Publications: Williams D.C, Cai M, Clore G.M. Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex. The Journal of biological chemistry 279:1449-57 (2004). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.