Transcription Factor

Accessions: 1hcq_F (3D-footprint 20241219)
Names: ER, ER-alpha, ESR1_HUMAN, Estradiol receptor, ESTROGEN RECEPTOR, Nuclear receptor subfamily 3 group A member 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P03372
Length: 71
Pfam Domains: 5-71 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 KETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGDYMCPATNQCTIDKNRRKSCQACR 60
61 LRKCYEVGMMK
Interface Residues: 15, 17, 24, 27, 28, 31, 32, 54
3D-footprint Homologues: 7wnh_D, 6l6q_B, 3g9m_B, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 2nll_B, 8hbm_B, 2ff0_A, 7xv6_B, 2han_A, 7prw_B, 5cbx_B, 5cbz_E, 3g6t_A, 8rm6_A
Binding Motifs: 1hcq_EF GGTCAnnnTGACC
Binding Sites: 1hcq_G
1hcq_H
Publications: Schwabe J. W. R., Chapman L., Finch J. T., Rhodes D. The crystal structure of the estrogen receptor DNA-binding domain bound to DNA: how receptors discriminate between their response elements. Cell 75:567-578 (1993). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.