Transcription Factor

Accessions: 6g1l_A (3D-footprint 20231221)
Names: Microphthalmia-associated transcription factor, MITF_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q08874
Length: 79
Pfam Domains: 6-59 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 AKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQR 60
61 EQQRAKDLENRQKKLEHAN
Interface Residues: 7, 10, 11, 13, 14, 15, 17, 18, 42, 44
3D-footprint Homologues: 1a0a_B, 7ssa_L, 5v0l_A, 4zpk_A, 7d8t_A, 7xi3_A, 5eyo_A, 1am9_A, 7f2f_B, 5nj8_D, 4h10_A, 6g1l_A, 5gnj_I, 7rcu_E, 5sy7_B, 4h10_B, 8osl_O, 5i50_B, 8osl_P, 2ypa_B, 1an4_A, 5nj8_C, 6od3_F, 2ypa_A, 5v0l_B, 7xi3_B
Binding Motifs: 6g1l_A CgTGa
Binding Sites: 6g1l_B
Publications: Möller K, Sigurbjornsdottir S, Arnthorsson AO, Pogenberg V, Dilshat R, Fock V, Brynjolfsdottir SH, Bindesboll C, Bessadottir M, Ogmundsdottir HM, Simonsen A, Larue L, Wilmanns M, Thorsson V, Steingrimsson E, Ogmundsdottir MH. MITF has a central role in regulating starvation-induced autophagy in melanoma. Sci Rep 9:1055 (2019). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.