Transcription Factor

Accessions: 5mez_A (3D-footprint 20231221)
Names: Deletion target in pancreatic carcinoma 4, hSMAD4, MAD homolog 4, MH1 domain of human Smad4, Mothers against decapentaplegic homolog 4, Mothers against DPP homolog 4, SMAD 4, SMAD family member 4, SMAD4_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q13485
Length: 125
Pfam Domains: 23-123 MH1 domain
Sequence:
(in bold interface residues)
1 ACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTI 60
61 QRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYE 120
121 RVVSP
Interface Residues: 65, 67, 69, 74, 101, 103
3D-footprint Homologues: 6fzs_A, 5nm9_A, 5od6_A, 6h3r_A, 5mey_A, 7qd4_A
Binding Motifs: 5mez_A GgCTa
Binding Sites: 5mez_D / 5mez_E
Publications: Martin-Malpartida P, Batet M, Kaczmarska Z, Freier R, Gomes T, Aragón E, Zou Y, Wang Q, Xi Q, Ruiz L, Vea A, Márquez JA, Massagué J, Macias MJ. Structural basis for genome wide recognition of 5-bp GC motifs by SMAD transcription factors. Nat Commun 8:2070 (2017). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.