Transcription Factor

Accessions: 5d4r_B (3D-footprint 20260701)
Names: Arabinose metabolism transcriptional repressor, ARAR_BACSU
Organisms: Bacillus subtilis, strain 168
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P96711
Length: 71
Pfam Domains: 7-70 Bacterial regulatory proteins, gntR family
34-68 DeoR-like helix-turn-helix domain
34-65 HTH domain
Sequence:
(in bold interface residues)
1 SEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLL 60
61 YSVQGGGTFVA
Interface Residues: 8, 32, 33, 34, 37, 43, 44, 45, 46, 47, 48, 49, 64, 65
3D-footprint Homologues: 7zla_B, 6wg7_G, 4p9u_F, 4wwc_B, 4h0e_A, 4u0y_B, 1h9t_B, 6za3_B
Binding Motifs: 5d4r_AB TGtnCGTaCCa
Binding Sites: 5d4r_T
5d4r_U
Publications: Jain D, Narayanan N, Nair DT. Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators. J Biol Chem 291:1235-42 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.