Transcription Factor
Accessions: | 5d4r_B (3D-footprint 20231221) |
Names: | Arabinose metabolism transcriptional repressor, ARAR_BACSU |
Organisms: | Bacillus subtilis, strain 168 |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P96711 |
Length: | 71 |
Pfam Domains: | 7-70 Bacterial regulatory proteins, gntR family 34-68 DeoR-like helix-turn-helix domain 34-65 HTH domain |
Sequence: (in bold interface residues) | 1 SEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLL 60 61 YSVQGGGTFVA |
Interface Residues: | 8, 32, 33, 34, 37, 43, 44, 45, 46, 47, 48, 49, 64, 65 |
3D-footprint Homologues: | 7zla_B, 6wg7_G, 4wwc_B, 4h0e_A, 4p9u_F, 4u0y_B, 1h9t_B, 6za3_B |
Binding Motifs: | 5d4r_AB TGtnCGTaCCa |
Binding Sites: | 5d4r_T 5d4r_U |
Publications: | Jain D, Narayanan N, Nair DT. Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators. J Biol Chem 291:1235-42 (2016). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.