Transcription Factor

						

			
Accessions: 1hbx_H (3D-footprint 20231221)

			
Names: ELK4_HUMAN, ETS domain-containing protein Elk-4, ETS-DOMAIN PROTEIN ELK-4, SAP-1, Serum response factor accessory protein 1, SRF accessory protein 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P28324
Length: 109
Pfam Domains:      3-84 Ets-domain
Sequence: 
(in bold interface residues)		   1 SAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLSRA   60
  61 LRYYYVKNIIKKVNGQKFVYKFVSYPEILNMSRNDYIHSGLYSSFTLNS
Interface Residues: 55, 56, 58, 59, 60, 62, 63, 77
3D-footprint Homologues: 1dux_F, 7jsa_J, 3zp5_A, 8ee9_F, 4mhg_A, 2stt_A, 4uno_A, 3jtg_A, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A, 4iri_A, 1bc8_C
Binding Motifs: 1hbx_DEH CTAATTAGsanTTCCG
Binding Sites: 1hbx_F
1hbx_X
			
Publications: Hassler M., Richmond T. J. The B-box dominates SAP-1-SRF interactions in the structure of the ternary complex.. EMBO J. 20:3018-3028 (2001). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.