Transcription Factor
| Accessions: | T025967_1.02 (CISBP 1.02), JUN_MOUSE (HOCOMOCO 10), P05627 (JASPAR 2024) |
| Names: | Jun, T025967_1.02;, Activator protein 1, AH119, AP1, JUN_MOUSE, Proto-oncogene c-Jun, Transcription factor AP-1, V-jun avian sarcoma virus 17 oncogene homolog, Transcription factor AP-1 subunit Jun, Transcription factor Jun |
| Organisms: | Mus musculus |
| Libraries: | CISBP 1.02 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | experiment type:PBM, family:bZIP |
| Length: | 334 |
| Pfam Domains: | 5-244 Jun-like transcription factor 253-316 bZIP transcription factor 258-313 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL 60 61 LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE 120 121 LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA 180 181 LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG 240 241 ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST 300 301 ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
| Interface Residues: | 261, 262, 264, 265, 266, 268, 269, 272, 273, 276 |
| 3D-footprint Homologues: | 2wt7_A, 1gd2_G, 2wt7_B, 1skn_P, 4eot_A, 7x5e_F, 8k8c_A, 5t01_B, 1dh3_C, 5vpe_C, 5vpe_D, 2dgc_A |
| Binding Motifs: | M0311_1.02 aTkACkyAw JUN_MOUSE.H10MO.A|M01183 mTGAGTCAy MA0489.2 dvTGACTCAtyh MA0489.3 TGACTCAt |
| Binding Sites: | MA0489.2.1 MA0489.2.10 / MA0489.2.13 MA0489.2.11 / MA0489.2.14 MA0489.2.12 / MA0489.2.15 MA0489.2.13 / MA0489.2.18 MA0489.2.14 / MA0489.2.19 MA0489.2.15 MA0489.2.16 MA0489.2.17 MA0489.2.18 MA0489.2.19 MA0489.2.2 MA0489.2.20 MA0489.2.2 / MA0489.2.3 MA0489.2.3 / MA0489.2.4 MA0489.2.4 / MA0489.2.5 MA0489.2.5 / MA0489.2.6 MA0489.2.6 / MA0489.2.7 MA0489.2.8 / MA0489.2.9 MA0489.2.10 / MA0489.2.9 MA0489.3.11 / MA0489.3.19 / MA0489.3.3 MA0489.3.10 / MA0489.3.14 / MA0489.3.7 / MA0489.3.8 MA0489.3.13 MA0489.3.16 / MA0489.3.17 / MA0489.3.18 / MA0489.3.20 MA0489.2.11 MA0489.2.12 MA0489.2.16 MA0489.2.17 MA0489.2.20 MA0489.2.7 MA0489.2.8 MA0489.3.1 MA0489.3.12 / MA0489.3.6 MA0489.3.15 / MA0489.3.4 / MA0489.3.9 MA0489.3.2 MA0489.3.5 |
| Publications: | Li M, Ge Q, Wang W, Wang J, Lu Z. c-Jun binding site identification in K562 cells. Journal of genetics and genomics = Yi chuan xue bao 38:235-42 (2011). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.