Transcription Factor

Accessions: SP1_DBD (HumanTF 1.0)
Names: SP1, SP1_HUMAN
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: P08047
Notes: Ensembl ID: ENSG00000185591; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Megaman
Length: 184
Pfam Domains: 78-102 Zinc finger, C2H2 type
78-102 C2H2-type zinc finger
94-121 Zinc-finger double domain
108-132 Zinc finger, C2H2 type
110-132 C2H2-type zinc finger
125-147 Zinc-finger double domain
138-160 C2H2-type zinc finger
138-160 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MAPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPY 60
61 CKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFT 120
121 RSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDS 180
181 GAGS
Interface Residues: 62, 67, 69, 71, 90, 91, 92, 93, 94, 96, 97, 99, 100, 103, 120, 121, 122, 123, 124, 126, 127, 128, 131, 148, 149, 150, 151, 152, 153, 154, 155, 156, 159
3D-footprint Homologues: 7ysf_A, 5yel_A, 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 7y3l_A, 8gn3_A, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 1ubd_C, 8ssq_A, 7w1m_H, 6blw_A, 5k5i_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 8h9h_G, 5v3j_F, 7y3m_I, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 3uk3_C, 8cuc_F, 5yj3_D, 1f2i_J, 2wbs_A, 7txc_E, 1llm_D, 2drp_D, 4m9v_C
Binding Motifs: SP1_DBD rCCmCrCCCmc
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.