Transcription Factor
| Accessions: | SP1_DBD (HumanTF 1.0) |
| Names: | SP1, SP1_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Uniprot: | P08047 |
| Notes: | Ensembl ID: ENSG00000185591; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Megaman |
| Length: | 184 |
| Pfam Domains: | 78-102 Zinc finger, C2H2 type 78-102 C2H2-type zinc finger 94-121 Zinc-finger double domain 108-132 Zinc finger, C2H2 type 110-132 C2H2-type zinc finger 125-147 Zinc-finger double domain 138-160 C2H2-type zinc finger 138-160 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MAPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPY 60 61 CKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFT 120 121 RSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDS 180 181 GAGS |
| Interface Residues: | 62, 67, 69, 71, 90, 91, 92, 93, 94, 96, 97, 99, 100, 103, 120, 121, 122, 123, 124, 126, 127, 128, 131, 148, 149, 150, 151, 152, 153, 154, 155, 156, 159 |
| 3D-footprint Homologues: | 7ysf_A, 5yel_A, 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 7y3l_A, 8gn3_A, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 1ubd_C, 8ssq_A, 7w1m_H, 6blw_A, 5k5i_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 8h9h_G, 5v3j_F, 7y3m_I, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 3uk3_C, 8cuc_F, 5yj3_D, 1f2i_J, 2wbs_A, 7txc_E, 1llm_D, 2drp_D, 4m9v_C |
| Binding Motifs: | SP1_DBD rCCmCrCCCmc |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.