Transcription Factor

Accessions: T057644_1.02 (CISBP 1.02)
Names: ces-1, T057644_1.02;
Organisms: Caenorhabditis elegans
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 270
Pfam Domains: 135-156 C2H2-type zinc finger
135-156 Zinc finger, C2H2 type
136-158 C2H2-type zinc finger
148-175 Zinc-finger double domain
166-188 C2H2-type zinc finger
166-184 C2H2-type zinc finger
191-213 C2H2-type zinc finger
191-213 Zinc finger, C2H2 type
191-213 C2H2-type zinc finger
206-229 Zinc-finger double domain
219-241 C2H2-type zinc finger
219-241 Zinc finger, C2H2 type
219-241 C2H2-type zinc finger
233-257 Zinc-finger double domain
247-260 C2H2-type zinc finger
247-269 Zinc finger, C2H2 type
247-269 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MITTPNISLTPTVAPPVDFPIIGNCDFQAQLWHLMSLHLQMQKSSAASTSSSSSSSTSSE 60
61 NLKKSPSSVQNTSVFSIDNILNSQKVPKLELENDEDVSSSPSPTCSTTGYTLDSLQNLDR 120
121 RSLNKKGPSSHNRCVCDKCGKSYATTSNLSRHKQTHRALDSPHAKQCPHCDRVYVSMPAL 180
181 SMHILTHNASHECNVCGKRFSRLWLLQGHLRSHTGLRPFSCAHCGKSFADRSNLRAHMLT 240
241 HTGDKRFECDKCGRRFALRAYLNRHLETCK
Interface Residues: 114, 116, 120, 144, 145, 147, 148, 151, 175, 176, 177, 178, 179, 181, 182, 184, 185, 188, 191, 200, 201, 202, 203, 204, 205, 206, 207, 208, 209, 229, 230, 231, 232, 233, 234, 235, 236, 237, 240, 257, 258, 259, 260, 261, 263, 264
3D-footprint Homologues: 7w1m_H, 6jnm_A, 5yel_A, 5ei9_F, 7n5w_A, 6blw_A, 5k5l_F, 2gli_A, 8ssu_A, 5kkq_D, 6ml4_A, 2drp_D, 8ssq_A, 8h9h_G, 6e94_A, 7ysf_A, 6a57_A, 2jpa_A, 1ubd_C, 2kmk_A, 1tf3_A, 8cuc_F, 7y3l_A, 3uk3_C, 6u9q_A, 4x9j_A, 1f2i_J, 1tf6_A, 1g2f_F, 5kl3_A, 5k5i_A, 5v3j_F, 4m9v_C, 2lt7_A, 7y3m_I, 2wbs_A, 8gn3_A, 7txc_E, 1llm_D, 5yj3_D
Binding Motifs: M0450_1.02 CAACAGG
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.