Transcription Factor
| Accessions: | 2ql2_D (3D-footprint 20250804) |
| Names: | Beta-cell E-box transcriptional activator 2, Beta2, NDF1_MOUSE, NeuroD1, Neurogenic differentiation factor 1 |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q60867 |
| Length: | 57 |
| Pfam Domains: | 1-52 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 RRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILR |
| Interface Residues: | 2, 5, 6, 8, 9, 10, 12, 13 |
| 3D-footprint Homologues: | 7z5k_B, 2ypa_A, 8osb_B, 6od3_F, 2ql2_D, 2ypa_B, 2ql2_A |
| Binding Motifs: | 2ql2_CD CCAGntGG |
| Binding Sites: | 2ql2_G 2ql2_H |
| Publications: | Longo A, Guanga G.P, Rose R.B. Crystal structure of E47-NeuroD1/beta2 bHLH domain-DNA complex: heterodimer selectivity and DNA recognition. Biochemistry 47:218-29 (2008). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.