Transcription Factor
Accessions: | 1bdv_C (3D-footprint 20241219) |
Names: | ARC FV10 REPRESSOR, RARC_BPP22 |
Organisms: | Enterobacteria phage P22 |
Libraries: | 3D-footprint 20241219 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P03050 |
Length: | 43 |
Pfam Domains: | 1-43 Arc-like DNA binding domain |
Sequence: (in bold interface residues) | 1 MPQVNLRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEG |
Interface Residues: | 16, 28, 32 |
3D-footprint Homologues: | 2gzk_A |
Binding Motifs: | 1bdv_ABCD TnTAGAAnnncTCTA |
Publications: | Schildbach J.F, Karzai A.W, Raumann B.E, Sauer R.T. Origins of DNA-binding specificity: role of protein contacts with the DNA backbone. Proceedings of the National Academy of Sciences of the United States of America 96:811-7 (1999). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.