Transcription Factor
| Accessions: | 3wtt_F (3D-footprint 20231221), 3wtx_A (3D-footprint 20231221), 3wtx_F (3D-footprint 20231221), 3wty_A (3D-footprint 20231221), 3wty_F (3D-footprint 20231221) |
| Names: | Acute myeloid leukemia 1 protein, CBF-alpha-2, Core-binding factor subunit alpha-2, Oncogene AML-1, PEA2-alpha B, PEBP2-alpha B, Polyomavirus enhancer-binding protein 2 alpha B subunit, Runt-related transcription factor 1, RUNX1_MOUSE, SL3-3 enhancer factor 1 alpha B subunit, SL3/AKV core-binding factor alpha B subunit |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q03347 |
| Length: | 118 |
| Pfam Domains: | 1-118 Runt domain |
| Sequence: (in bold interface residues) | 1 GELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVAKGDVPDGTLVTVMAGNDENYSAELRN 60 61 ATAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPR |
| Interface Residues: | 21, 83, 111, 112, 115, 118 |
| 3D-footprint Homologues: | 4l18_E, 6vg8_D, 3wts_A, 6vgd_D, 4l0y_A |
| Binding Motifs: | 3wtt_F TGTGGctT 3wtx_AC GCCACATCCT 3wtx_F TGTGGcTt 3wty_AC GCCACATCCT 3wty_F TGTGGC |
| Binding Sites: | 3wtt_I / 3wtx_I / 3wty_I 3wtt_J / 3wtx_J / 3wty_J |
| Publications: | Shiina M, Hamada K, Inoue-Bungo T, Shimamura M, Uchiyama A, Baba S, Sato K, Yamamoto M, Ogata K. A Novel Allosteric Mechanism on Protein-DNA Interactions underlying the Phosphorylation-Dependent Regulation of Ets1 Target Gene Expressions. Journal of molecular biology 427:1655-69 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.