Transcription Factor

						

			
Accessions: 5x07_F (3D-footprint 20231221)

			
Names: Forkhead box protein A2, FOXA2_HUMAN, Hepatocyte nuclear factor 3-beta, HNF-3-beta, HNF-3B, TCF-3B, Transcription factor 3B
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9Y261
Length: 85
Pfam Domains:      5-84 Fork head domain
Sequence: 
(in bold interface residues)		   1 GPHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFN   60
  61 DCFLKVPRSPDKPGKGSFWTLHPDS
Interface Residues: 45, 48, 50, 51, 52, 54, 55, 56, 58, 59, 68, 75
3D-footprint Homologues: 3l2c_A, 7vox_H, 2hdc_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 3qrf_G
Binding Motifs: 5x07_F TAAACA
Binding Sites: 5x07_D
5x07_E
			
Publications: Li J, Dantas Machado AC, Guo M, Sagendorf JM, Zhou Z, Jiang L, Chen X, Wu D, Qu L, Chen Z, Chen L, Rohs R, Chen Y. Structure of the Forkhead Domain of FOXA2 Bound to a Complete DNA Consensus Site. Biochemistry 56:3745-3753 (2017). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.