Transcription Factor

Accessions: BCL6B_DBD (HumanTF 1.0)
Names: A8KA13_HUMAN, B-cell CLL/lymphoma 6, member B, BCL6B, cDNA FLJ16548 fis, clone PLACE7000410, highly similar to B-cell CLL/lymphoma 6 member B protein, cDNA FLJ77637, cDNA FLJ77701, highly similar to Homo sapiens B-cell CLL/lymphoma 6, member B (zinc finger protein, Zinc finger protein
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: A8KA13
Notes: Ensembl ID: ENSG00000161940; DNA-binding domain sequence; TF family: znfC2H2; Clone source: MGC
Length: 174
Pfam Domains: 22-45 C2H2-type zinc finger
23-45 Zinc finger, C2H2 type
23-45 C2H2-type zinc finger
37-61 Zinc-finger double domain
51-69 Zinc-finger of C2H2 type
51-62 C2H2-type zinc finger
51-73 Zinc finger, C2H2 type
51-71 C2H2-type zinc finger
65-89 Zinc-finger double domain
78-89 C2H2-type zinc finger
79-101 C2H2-type zinc finger
79-101 Zinc finger, C2H2 type
93-118 Zinc-finger double domain
107-129 Zinc finger, C2H2 type
107-129 C2H2-type zinc finger
107-122 C2H2-type zinc finger
122-145 Zinc-finger double domain
135-158 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MAAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSICGARF 60
61 NRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQ 120
121 TLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP
Interface Residues: 9, 13, 33, 34, 35, 36, 37, 39, 40, 42, 43, 44, 46, 51, 61, 62, 63, 64, 65, 67, 68, 72, 89, 90, 91, 92, 93, 95, 96, 117, 118, 119, 120, 121, 123, 124, 125, 127, 145, 146, 147, 148, 149, 150, 151, 152, 153
3D-footprint Homologues: 7w1m_H, 7y3l_A, 5v3j_F, 7n5w_A, 5kkq_D, 1llm_D, 6wmi_A, 8ssq_A, 5und_A, 8ssu_A, 2gli_A, 8gn3_A, 8h9h_G, 7eyi_G, 7y3m_I, 2i13_A, 5yel_A, 2jpa_A, 1ubd_C, 2kmk_A, 6jnm_A, 8cuc_F, 1tf3_A, 1tf6_A, 6u9q_A, 4x9j_A, 5kl3_A, 5ei9_F, 1mey_C, 1f2i_J, 5k5i_A, 6ml4_A, 1g2f_F, 6blw_A, 2lt7_A, 6e94_A, 7ysf_A, 7txc_E, 5yj3_D, 2drp_D, 6a57_A, 3uk3_C, 2wbs_A, 4m9v_C
Binding Motifs: BCL6B_DBD TGCTTTCTAGGAATTmm
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.