Transcription Factor
Accessions: | BCL6B_DBD (HumanTF 1.0) |
Names: | A8KA13_HUMAN, B-cell CLL/lymphoma 6, member B, BCL6B, cDNA FLJ16548 fis, clone PLACE7000410, highly similar to B-cell CLL/lymphoma 6 member B protein, cDNA FLJ77637, cDNA FLJ77701, highly similar to Homo sapiens B-cell CLL/lymphoma 6, member B (zinc finger protein, Zinc finger protein |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
Uniprot: | A8KA13 |
Notes: | Ensembl ID: ENSG00000161940; DNA-binding domain sequence; TF family: znfC2H2; Clone source: MGC |
Length: | 174 |
Pfam Domains: | 22-45 C2H2-type zinc finger 23-45 Zinc finger, C2H2 type 23-45 C2H2-type zinc finger 37-61 Zinc-finger double domain 51-69 Zinc-finger of C2H2 type 51-62 C2H2-type zinc finger 51-73 Zinc finger, C2H2 type 51-71 C2H2-type zinc finger 65-89 Zinc-finger double domain 78-89 C2H2-type zinc finger 79-101 C2H2-type zinc finger 79-101 Zinc finger, C2H2 type 93-118 Zinc-finger double domain 107-129 Zinc finger, C2H2 type 107-129 C2H2-type zinc finger 107-122 C2H2-type zinc finger 122-145 Zinc-finger double domain 135-158 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 MAAVAGCSSGLDSLVPGDEDKPYKCQLCRSSFRYKGNLASHRTVHTGEKPYHCSICGARF 60 61 NRPANLKTHSRIHSGEKPYKCETCGSRFVQVAHLRAHVLIHTGEKPYPCPTCGTRFRHLQ 120 121 TLKSHVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP |
Interface Residues: | 9, 13, 33, 34, 35, 36, 37, 39, 40, 42, 43, 44, 46, 51, 61, 62, 63, 64, 65, 67, 68, 72, 89, 90, 91, 92, 93, 95, 96, 117, 118, 119, 120, 121, 123, 124, 125, 127, 145, 146, 147, 148, 149, 150, 151, 152, 153 |
3D-footprint Homologues: | 7w1m_H, 7y3l_A, 5v3j_F, 7n5w_A, 5kkq_D, 1llm_D, 6wmi_A, 8ssq_A, 5und_A, 8ssu_A, 2gli_A, 8gn3_A, 8h9h_G, 7eyi_G, 7y3m_I, 2i13_A, 5yel_A, 2jpa_A, 1ubd_C, 2kmk_A, 6jnm_A, 8cuc_F, 1tf3_A, 1tf6_A, 6u9q_A, 4x9j_A, 5kl3_A, 5ei9_F, 1mey_C, 1f2i_J, 5k5i_A, 6ml4_A, 1g2f_F, 6blw_A, 2lt7_A, 6e94_A, 7ysf_A, 7txc_E, 5yj3_D, 2drp_D, 6a57_A, 3uk3_C, 2wbs_A, 4m9v_C |
Binding Motifs: | BCL6B_DBD TGCTTTCTAGGAATTmm |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.