Transcription Factor
| Accessions: | SP9 (HT-SELEX2 May2017) |
| Names: | ENSG00000217236, SP9 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4, TF family: ZZnf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 113 |
| Pfam Domains: | 17-41 C2H2-type zinc finger 17-41 Zinc finger, C2H2 type 33-60 Zinc-finger double domain 47-71 C2H2-type zinc finger 47-71 Zinc finger, C2H2 type 64-86 Zinc-finger double domain 77-100 C2H2-type zinc finger 77-99 Zinc finger, C2H2 type 77-97 Zinc-finger of C2H2 type |
| Sequence: (in bold interface residues) | 1 AERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTR 60 61 SDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHIKTHNGGGGGKKGSDSDT |
| Interface Residues: | 6, 29, 30, 31, 32, 33, 35, 36, 38, 39, 42, 58, 59, 60, 61, 62, 63, 65, 66, 67, 70, 87, 88, 89, 90, 91, 92, 93, 94, 95 |
| 3D-footprint Homologues: | 5yel_A, 6jnm_A, 8cuc_F, 1tf3_A, 6ml4_A, 7n5w_A, 1ubd_C, 7ysf_A, 5ei9_F, 8ssq_A, 1mey_C, 7w1m_H, 5und_A, 5k5i_A, 2kmk_A, 8ssu_A, 2gli_A, 8gn3_A, 1g2f_F, 6blw_A, 5kkq_D, 1tf6_A, 6u9q_A, 4x9j_A, 2i13_A, 5kl3_A, 7eyi_G, 8h9h_G, 6wmi_A, 2lt7_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 3uk3_C, 7y3l_A, 2wbs_A, 5yj3_D, 2drp_D, 1f2i_J, 1llm_D, 7txc_E, 4m9v_C, 5v3j_F |
| Binding Motifs: | SP9_2 rcCmCGCCCmcy SP9_methyl_1 rcCACGCCCmcy |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.