Transcription Factor

Accessions: SP9 (HT-SELEX2 May2017)
Names: ENSG00000217236, SP9
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4, TF family: ZZnf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4
Length: 113
Pfam Domains: 17-41 C2H2-type zinc finger
17-41 Zinc finger, C2H2 type
33-60 Zinc-finger double domain
47-71 C2H2-type zinc finger
47-71 Zinc finger, C2H2 type
64-86 Zinc-finger double domain
77-100 C2H2-type zinc finger
77-99 Zinc finger, C2H2 type
77-97 Zinc-finger of C2H2 type
Sequence:
(in bold interface residues)
1 AERLGPAGASLRRKGLHSCHIPGCGKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTR 60
61 SDELQRHLRTHTGEKRFACPVCNKRFMRSDHLSKHIKTHNGGGGGKKGSDSDT
Interface Residues: 6, 29, 30, 31, 32, 33, 35, 36, 38, 39, 42, 58, 59, 60, 61, 62, 63, 65, 66, 67, 70, 87, 88, 89, 90, 91, 92, 93, 94, 95
3D-footprint Homologues: 5yel_A, 8cuc_F, 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 8gn3_A, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 6blw_A, 5k5i_A, 8h9h_G, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 2jpa_A, 7y3l_A, 3uk3_C, 1llm_D, 2drp_D, 5yj3_D, 1f2i_J, 2wbs_A, 7txc_E, 4m9v_C, 5v3j_F
Binding Motifs: SP9_2 rcCmCGCCCmcy
SP9_methyl_1 rcCACGCCCmcy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.