Transcription Factor
| Accessions: | KLF4 (HT-SELEX2 May2017) |
| Names: | ENSG00000136826, KLF4 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 103 |
| Pfam Domains: | 20-44 C2H2-type zinc finger 20-44 Zinc finger, C2H2 type 36-58 Zinc-finger double domain 50-74 Zinc finger, C2H2 type 50-74 C2H2-type zinc finger 67-91 Zinc-finger double domain 80-102 Zinc finger, C2H2 type 80-102 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 EEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWK 60 61 FARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF |
| Interface Residues: | 32, 33, 34, 35, 36, 38, 39, 41, 42, 45, 61, 62, 63, 64, 65, 66, 68, 69, 70, 73, 90, 91, 92, 93, 94, 95, 96, 97, 98, 101 |
| 3D-footprint Homologues: | 6ml4_A, 5v3j_F, 3uk3_C, 8cuc_F, 1tf3_A, 7n5w_A, 6jnm_A, 1tf6_A, 5ei9_F, 1g2f_F, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 6blw_A, 2kmk_A, 1llm_D, 6u9q_A, 8ssu_A, 5kkq_D, 2gli_A, 5kl3_A, 8h9h_G, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 2jpa_A, 5k5i_A, 8gn3_A, 7y3l_A, 2wbs_A, 7txc_E, 5yel_A, 2drp_D, 4x9j_A, 1f2i_J, 4m9v_C, 5yj3_D |
| Binding Motifs: | KLF4_2 srCCACrCCCh KLF4_methyl_1 crCCmCrCCCa |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.