Transcription Factor

Accessions: KLF4 (HT-SELEX2 May2017)
Names: ENSG00000136826, KLF4
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 103
Pfam Domains: 20-44 C2H2-type zinc finger
20-44 Zinc finger, C2H2 type
36-58 Zinc-finger double domain
50-74 C2H2-type zinc finger
50-74 Zinc finger, C2H2 type
67-91 Zinc-finger double domain
80-102 C2H2-type zinc finger
80-102 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 EEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWK 60
61 FARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF
Interface Residues: 32, 33, 34, 35, 36, 38, 39, 41, 42, 45, 61, 62, 63, 64, 65, 66, 68, 69, 70, 73, 90, 91, 92, 93, 94, 95, 96, 97, 98, 101
3D-footprint Homologues: 1tf3_A, 7n5w_A, 6jnm_A, 6ml4_A, 5v3j_F, 3uk3_C, 8cuc_F, 6u9q_A, 8ssu_A, 5kkq_D, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 6blw_A, 2kmk_A, 1llm_D, 8h9h_G, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 2jpa_A, 5k5i_A, 8gn3_A, 7y3l_A, 5yel_A, 2drp_D, 4x9j_A, 1f2i_J, 2wbs_A, 7txc_E, 4m9v_C, 5yj3_D
Binding Motifs: KLF4_2 srCCACrCCCh
KLF4_methyl_1 crCCmCrCCCa
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.