Transcription Factor
| Accessions: | DBP (HT-SELEX2 May2017) |
| Names: | DBP, ENSG00000105516 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 88 |
| Pfam Domains: | 17-70 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 QPIMKKARKIQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKENQISVRAAFLEKENALL 60 61 RQEVVAVRQELSHYRAVLSRYQAQHGAL |
| Interface Residues: | 25, 28, 29, 31, 32, 35, 36 |
| 3D-footprint Homologues: | 8k8c_A, 8k86_A |
| Binding Motifs: | DBP_2 srTTAyGTAAys DBP_4 brTTACGTAAyg DBP_methyl_1 yrTTAyGTAAyr DBP_methyl_3 yrTTAyGTAAyr |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.