Transcription Factor

Accessions: 1k78_A (3D-footprint 20231221), 1k78_E (3D-footprint 20231221), 1mdm_A (3D-footprint 20231221)
Names: B-cell-specific transcription factor, BSAP, Paired box protein Pax-5, Paired Box Protein Pax5, PAX5_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q02548
Length: 124
Pfam Domains: 2-122 'Paired box' domain
Sequence:
(in bold interface residues)
1 GVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSI 60
61 KPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRI 120
121 IRTK
Interface Residues: 11, 43, 44, 46, 48, 49, 65, 68, 71, 113, 114, 115, 116, 118, 119, 122
3D-footprint Homologues: 1pdn_C, 6pax_A, 1k78_A
Binding Motifs: 1k78_A CCAnTnnanCnTnTCT
1k78_EF CGGAGAnnnGnnnnanngG
1mdm_AB CCAnGnnnnCnnnTCTCCG
Binding Sites: 1k78_G
1k78_H
Publications: Garvie C. W., Hagman J., Wolberger C. Structural studies of Ets-1/Pax5 complex formation on DNA.. Mol. Cell 8:1267-1276 (2001). [Pubmed]

Garvie C.W, Pufall M.A, Graves B.J, Wolberger C. Structural analysis of the autoinhibition of Ets-1 and its role in protein partnerships. The Journal of biological chemistry 277:45529-36 (2002). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.