Transcription Factor

Accessions: BHLHE23_DBD (HumanTF 1.0), BHLHE23 (HT-SELEX2 May2017)
Names: BHE23_HUMAN, bHLHb4, BHLHE23, Class B basic helix-loop-helix protein 4, Class E basic helix-loop-helix protein 23, ENSG00000125533
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q8NDY6
Notes: Ensembl ID: ENSG00000125533; DNA-binding domain sequence; TF family: bHLH; Clone source: Gene synthesis, TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: HT-SELEX Hamming distance: 1 cycle: 4b0, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: bHLH experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4b0
Length: 107
Pfam Domains: 29-79 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 DAFEQRRRRRGPGSAADGRRRPREQRSLRLSINARERRRMHDLNDALDGLRAVIPYAHSP 60
61 SVRKLSKIATLLLAKNYILMQAQALDEMRRLVAFLNQGQGLAAPVNA
Interface Residues: 29, 33, 35, 36, 39, 40
3D-footprint Homologues: 8osb_B, 7d8t_A, 8osl_P
Binding Motifs: BHLHE23_DBD AmCATATGyy
BHLHE23_2 amCATATGky
BHLHE23_4 rsCATATGkY
BHLHE23_methyl_1 AmCATATGky
BHLHE23_methyl_3 RmCATATGgT
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.