Transcription Factor

Accessions: 4qr9_A (3D-footprint 20260701), 4qr9_B (3D-footprint 20260701)
Names: Amphoterin, Heparin-binding protein p30, High mobility group protein 1, High mobility group protein B1, HMG-1, HMGB1_RAT
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P63159
Length: 75
Pfam Domains: 3-70 Domain of unknown function (DUF1898)
8-73 HMG (high mobility group) box
Sequence:
(in bold interface residues)
1 GSKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAK 60
61 ADKARYEREMKTYIP
Interface Residues: 6, 8, 9, 11, 12, 13, 14, 15, 19, 21, 27, 28, 31, 32, 33, 34, 37
3D-footprint Homologues: 7m5w_A, 2gzk_A, 1j5n_A, 3tmm_A, 1qrv_A, 1o4x_B, 3u2b_C, 1ckt_A
Binding Motifs: 4qr9_AB tCGa
Binding Sites: 4qr9_C
4qr9_D
Publications: Sánchez-Giraldo R, Acosta-Reyes FJ, Malarkey CS, Saperas N, Churchill ME, Campos JL. Two high-mobility group box domains act together to underwind and kink DNA. Acta Crystallogr D Biol Crystallogr : (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.