Transcription Factor

Accessions: 4s2q_D (3D-footprint 20241219)
Names: mSox9, SOX9_MOUSE, Transcription factor SOX-9
Organisms: Mus musculus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q04887
Length: 76
Pfam Domains: 3-71 HMG (high mobility group) box
4-66 Domain of unknown function (DUF1898)
Sequence:
(in bold interface residues)
1 PHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLR 60
61 VQHKKDHPDYKYQPRR
Interface Residues: 5, 8, 10, 11, 14, 18, 29, 30, 31, 34, 72
3D-footprint Homologues: 2gzk_A, 2lef_A, 7m5w_A
Binding Motifs: 4s2q_D wACAaAg
Binding Sites: 4s2q_A
4s2q_B
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.