Transcription Factor
| Accessions: | TGA2 (ArabidopsisPBM 20140210), T023873_1.02 (CISBP 1.02), P43273 (JASPAR 2024), T23356 (AthalianaCistrome v4_May2016) |
| Names: | AHBP-1B, TGA2, T023873_1.02;, AtbZIP20, bZIP transcription factor 20, HBP-1b homolog, TGA2_ARATH, Transcription factor TGA2, AT5G06950, T23356; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | ArabidopsisPBM 20140210 1, CISBP 1.02 2, JASPAR 2024 3, AthalianaCistrome v4_May2016 4 1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed] 2 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 4 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | bZIP, experiment type:PBM, family:bZIP, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq |
| Length: | 330 |
| Pfam Domains: | 44-88 Basic region leucine zipper 45-86 bZIP transcription factor 127-205 Seed dormancy control |
| Sequence: (in bold interface residues) | 1 MADTSPRTDVSTDDDTDHPDLGSEGALVNTAASDSSDRSKGKMDQKTLRRLAQNREAARK 60 61 SRLRKKAYVQQLENSRLKLTQLEQELQRARQQGVFISGTGDQAHSTGGNGALAFDAEHSR 120 121 WLEEKNKQMNELRSALNAHAGDSELRIIVDGVMAHYEELFRIKSNAAKNDVFHLLSGMWK 180 181 TPAERCFLWLGGFRSSELLKLLANQLEPMTERQLMGINNLQQTSQQAEDALSQGMESLQQ 240 241 SLADTLSSGTLGSSSSGNVASYMGQMAMAMGKLGTLEGFIRQADNLRLQTLQQMIRVLTT 300 301 RQSARALLAIHDYFSRLRALSSLWLARPRE |
| Interface Residues: | 54, 57, 58, 61, 62 |
| 3D-footprint Homologues: | 1dh3_C |
| Binding Motifs: | TGA2 rTGACGTCAy TGA2_2 kACGTCAkCa M0269_1.02 krTGACGtma MA1068.1 ACGTCAkC M0185 ygmCGYCAyCa M0216 rrTGACGTCAkCawywwykw MA1068.2 wwgaTGACGTCAycw MA1068.3 aTGACGTCAy |
| Binding Sites: | MA1068.3.3 / MA1068.3.4 MA1068.3.10 / MA1068.3.19 / MA1068.3.20 / MA1068.3.7 / MA1068.3.8 / MA1068.3.9 MA1068.1.1 MA1068.1.10 MA1068.1.11 MA1068.1.12 MA1068.1.13 MA1068.1.14 MA1068.1.15 MA1068.1.16 MA1068.1.17 MA1068.1.18 MA1068.1.19 MA1068.1.2 MA1068.1.20 MA1068.1.3 MA1068.1.4 MA1068.1.5 MA1068.1.6 MA1068.1.7 MA1068.1.8 MA1068.1.9 MA1068.2.1 MA1068.2.2 MA1068.2.3 MA1068.2.4 MA1068.2.5 MA1068.2.6 MA1068.2.7 MA1068.2.8 MA1068.2.9 MA1068.2.10 MA1068.2.11 MA1068.2.12 MA1068.2.13 MA1068.2.14 MA1068.2.15 MA1068.2.16 MA1068.2.17 MA1068.2.18 MA1068.2.19 MA1068.2.20 MA1068.3.15 MA1068.3.16 MA1068.3.1 / MA1068.3.12 MA1068.3.11 MA1068.3.13 / MA1068.3.2 MA1068.3.14 MA1068.3.17 MA1068.3.18 MA1068.3.5 MA1068.3.6 |
| Publications: | Despres C., DeLong C., Glaze S., Liu E., Fobert P. R. The Arabidopsis NPR1/NIM1 protein enhances the DNA binding activity of a subgroup of the TGA family of bZIP transcription factors.. Plant Cell 12:279-290 (2000). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.