Transcription Factor

Accessions: T102341_1.02 (CISBP 1.02)
Names: HOXF, T102341_1.02;
Organisms: Nematostella vectensis
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:Homeodomain
Length: 60
Pfam Domains: 2-58 Homeobox domain
Sequence:
(in bold interface residues)
1 GKRKRTAYTRKQLLELEKEFHFNHFLTKERRSEMASQLNLTERQVKIWFQNRRMKWKKCN 60
Interface Residues: 2, 3, 4, 5, 43, 44, 46, 47, 50, 51, 53, 54, 55, 58
3D-footprint Homologues: 8ejp_B, 6a8r_A, 1ig7_A, 3cmy_A, 8pmf_A, 5zfz_A, 1puf_A, 3d1n_M, 1fjl_B, 1nk2_P, 1zq3_P, 2lkx_A, 1jgg_B, 6m3d_C, 3lnq_A, 2ld5_A, 1b72_A, 3a01_E, 8osb_E, 7q3o_C, 5jlw_D, 3rkq_B, 8eml_B, 6es3_K, 4xrs_G, 2hdd_A, 4cyc_A, 2r5y_A, 5flv_I, 2hos_A, 9b8u_A, 1au7_A, 5zjt_E, 1puf_B, 8ik5_C, 7psx_B, 5hod_A, 7xrc_C, 1e3o_C, 1le8_A, 4j19_B, 2xsd_C, 4qtr_D, 1o4x_A, 1du0_A, 8g87_X, 8bx1_A
Binding Motifs: M1205_1.02 cTAATkAC
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.