Transcription Factor
| Accessions: | Q64279 (JASPAR 2024) |
| Names: | eHAND, Extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1, HAND1_MOUSE, Heart- and neural crest derivatives-expressed protein 1, Helix-loop-helix transcription factor expressed in extraembryonic mesoderm and trophoblast, Th1, Thing-1 |
| Organisms: | Mus musculus |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q64279 |
| Length: | 216 |
| Pfam Domains: | 96-146 Helix-loop-helix DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MNLVGSYAHHHHHHHSHPPHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGG 60 61 PPPTTAVAAAAYGPDARPSQSPGRLEALGSRLPKRKGSGPKKERRRTESINSAFAELREC 120 121 IPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAFKAELKKTDGGRESKRKRE 180 181 LPQQPESFPPASGPGEKRIKGRTGWPQQVWALELNQ |
| Interface Residues: | 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 130, 132 |
| 3D-footprint Homologues: | 7z5k_B, 7xhv_B, 7xi3_B, 1an4_A, 7f2f_B, 7ssa_L, 8ia3_B, 4h10_A, 2ql2_D, 2ypa_A, 8osb_B, 5eyo_A, 8osl_P, 5gnj_I, 5i50_B, 1am9_A, 5v0l_B |
| Binding Motifs: | MA0092.1 srTCTGGmwt UN0674.1 wytCCAGACCtss MA0092.2 rTCTGGmwt |
| Binding Sites: | MA0092.2.3 MA0092.1.1 MA0092.1.10 MA0092.1.11 MA0092.1.12 MA0092.1.13 MA0092.1.14 MA0092.1.15 MA0092.1.16 MA0092.1.17 MA0092.1.18 MA0092.1.19 MA0092.1.2 MA0092.1.20 MA0092.1.3 MA0092.1.4 MA0092.1.5 MA0092.1.6 MA0092.1.7 MA0092.1.8 MA0092.1.9 UN0674.1.1 UN0674.1.10 UN0674.1.11 UN0674.1.12 UN0674.1.13 UN0674.1.14 UN0674.1.15 UN0674.1.16 UN0674.1.17 UN0674.1.18 UN0674.1.19 UN0674.1.2 UN0674.1.20 UN0674.1.3 UN0674.1.4 UN0674.1.5 UN0674.1.6 UN0674.1.7 UN0674.1.8 UN0674.1.9 MA0092.2.1 MA0092.2.10 MA0092.2.11 MA0092.2.12 MA0092.2.13 MA0092.2.14 MA0092.2.15 MA0092.2.16 MA0092.2.17 MA0092.2.18 MA0092.2.19 MA0092.2.2 MA0092.2.20 MA0092.2.4 MA0092.2.5 MA0092.2.6 MA0092.2.7 MA0092.2.8 MA0092.2.9 |
| Publications: | Hollenberg S. M., Sternglanz R., Cheng P. F., Weintraub H. Identification of a new family of tissue-specific basic helix-loop-helix proteins with a two-hybrid system. Mol. Cell. Biol. 15:3813-3822 (1995). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.