Transcription Factor
| Accessions: | MAF (HT-SELEX2 May2017) |
| Names: | ENSG00000178573, MAF |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4 |
| Length: | 129 |
| Pfam Domains: | 16-109 bZIP Maf transcription factor |
| Sequence: (in bold interface residues) | 1 GALHPHHAAGGLHFDDRFSDEQLVTMSVRELNRQLRGVSKEEVIRLKQKRRTLKNRGYAQ 60 61 SCRFKRVQQRHVLESEKNQLLQQVDHLKQEISRLVRERDAYKEKYEKLVSSGFRENGSSS 120 121 DNPSSPEFF |
| Interface Residues: | 51, 55, 58, 59, 62, 63 |
| 3D-footprint Homologues: | 7x5e_F, 2wt7_B, 4eot_A, 7x5e_E |
| Binding Motifs: | MAF_2 ryGCTGACr MAF_6 wTGCTGAsTCAGCAw MAF_7 tTGcTkAyGTmAGCAw MAF_8 wTGCTGAcdhwGCA MAF_methyl_1 dyGCTGAcd MAF_methyl_3 wyGCTGAsTCAGCrw MAF_methyl_4 wTGCTGAyGTCAGCAw MAF_methyl_5 wYGCTGACdcdGCr |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.