Transcription Factor

Accessions: Bteb2 (FlyZincFinger 1.0 )
Names: CG2932
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 106
Pfam Domains: 12-36 C2H2-type zinc finger
14-36 Zinc finger, C2H2 type
28-45 Zinc-finger double domain
42-66 C2H2-type zinc finger
42-66 Zinc finger, C2H2 type
59-82 Zinc-finger double domain
72-94 Zinc finger, C2H2 type
72-94 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 QMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELA 60
61 RHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHERRLLAASRAGR
Interface Residues: 24, 25, 26, 27, 28, 30, 31, 33, 34, 37, 53, 54, 55, 56, 57, 58, 60, 61, 62, 65, 83, 84, 85, 86, 87, 88, 89, 90
3D-footprint Homologues: 6ml4_A, 5v3j_F, 7n5w_A, 1tf3_A, 6jnm_A, 2gli_A, 1g2f_F, 7eyi_G, 6a57_A, 8ssu_A, 1tf6_A, 4x9j_A, 2i13_A, 6blw_A, 5kkq_D, 1ubd_C, 6u9q_A, 5ei9_F, 1mey_C, 5kl3_A, 7ysf_A, 6wmi_A, 2kmk_A, 8ssq_A, 7w1m_H, 5und_A, 8h9h_G, 2lt7_A, 7y3m_I, 6e94_A, 2jpa_A, 5k5i_A, 5yel_A, 8cuc_F, 7y3l_A, 5k5l_F, 8gn3_A, 1llm_D, 2wbs_A, 7txc_E, 3uk3_C, 1f2i_J, 4m9v_C, 2drp_D, 5yj3_D
Binding Motifs: Bteb2_SANGER_2.5_FBgn0025679 GGGGGCGk
Bteb2_SOLEXA_2.5_FBgn0025679 kwrGGGGGCGkrwm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.