Transcription Factor
| Accessions: | Bteb2 (FlyZincFinger 1.0 ) |
| Names: | CG2932 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 106 |
| Pfam Domains: | 12-36 C2H2-type zinc finger 14-36 Zinc finger, C2H2 type 28-45 Zinc-finger double domain 42-66 C2H2-type zinc finger 42-66 Zinc finger, C2H2 type 59-82 Zinc-finger double domain 72-94 C2H2-type zinc finger 72-94 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 QMSENAAGERGYLCTFGNCEKIYAKPAHLKAHLRRHLGEKPYVCSWPDCVWRFSRSDELA 60 61 RHKRSHSGVKPYKCDYCSKCFARSDHLTKHRKVHERRLLAASRAGR |
| Interface Residues: | 24, 25, 26, 27, 28, 30, 31, 33, 34, 37, 53, 54, 55, 56, 57, 58, 60, 61, 62, 65, 83, 84, 85, 86, 87, 88, 89, 90 |
| 3D-footprint Homologues: | 6ml4_A, 5v3j_F, 1tf3_A, 7n5w_A, 6jnm_A, 6a57_A, 2kmk_A, 7ysf_A, 8ssq_A, 7w1m_H, 6blw_A, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 5kkq_D, 1tf6_A, 5ei9_F, 1g2f_F, 5kl3_A, 1ubd_C, 8h9h_G, 2lt7_A, 6e94_A, 7y3m_I, 2jpa_A, 5k5i_A, 5yel_A, 8cuc_F, 7y3l_A, 1llm_D, 5k5l_F, 1f2i_J, 2wbs_A, 8gn3_A, 3uk3_C, 7txc_E, 4m9v_C, 2drp_D, 5yj3_D |
| Binding Motifs: | Bteb2_SANGER_2.5_FBgn0025679 GGGGGCGk Bteb2_SOLEXA_2.5_FBgn0025679 kwrGGGGGCGkrwm |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.