Transcription Factor

Accessions: T012423_1.02 (CISBP 1.02), Q9LTC7 (JASPAR 2024), T13705 (AthalianaCistrome v4_May2016)
Names: bHLH34, T012423_1.02;, AtbHLH34, Basic helix-loop-helix protein 34, BH034_ARATH, bHLH 34, bHLH transcription factor bHLH034, Transcription factor bHLH34, Transcription factor EN 135, AT3G23210, T13705;
Organisms: Arabidopsis thaliana
Libraries: CISBP 1.02 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: experiment type:PBM, family:bHLH, ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq
Length: 320
Pfam Domains: 166-213 Helix-loop-helix DNA-binding domain
Sequence:
(in bold interface residues)
1 MYPSIEDDDDLLAALCFDQSNGVEDPYGYMQTNEDNIFQDFGSCGVNLMQPQQEQFDSFN 60
61 GNLEQVCSSFRGGNNGVVYSSSIGSAQLDLAASFSGVLQQETHQVCGFRGQNDDSAVPHL 120
121 QQQQGQVFSGVVEINSSSSVGAVKEEFEEECSGKRRRTGSCSKPGTKACREKLRREKLND 180
181 KFMDLSSVLEPGRTPKTDKSAILDDAIRVVNQLRGEAHELQETNQKLLEEIKSLKADKNE 240
241 LREEKLVLKAEKEKMEQQLKSMVVPSPGFMPSQHPAAFHSHKMAVAYPYGYYPPNMPMWS 300
301 PLPPADRDTSRDLKNLPPVA
Interface Residues: 162, 168, 171, 172, 174, 175, 220
3D-footprint Homologues: 4efj_A, 8osl_O, 5eyo_A, 5gnj_I, 4h10_A, 8ia3_B, 4h10_B
Binding Motifs: M0157_1.02 gCACGTGk
MA0962.1 gCACGTGk
M0166 gtgrwwgrCACGTGycarcwygw
M0168 wGrCACGTGyhwkmcacryky
MA0962.2 gCACGTG
Publications: Fernández-Calvo P, Chini A, Fernández-Barbero G, Chico J.M, Gimenez-Ibanez S, Geerinck J, Eeckhout D, Schweizer F, Godoy M, Franco-Zorrilla J.M, Pauwels L, Witters E, Puga M.I, Paz-Ares J, Goossens A, Reymond P, De Jaeger G, Solano R. The Arabidopsis bHLH transcription factors MYC3 and MYC4 are targets of JAZ repressors and act additively with MYC2 in the activation of jasmonate responses. The Plant cell 23:701-15 (2011). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.