Transcription Factor

Accessions: 2xsd_C (3D-footprint 20231221)
Names: Oct-6, Octamer-binding protein 6, Octamer-binding transcription factor 6, OTF-6, PO3F1_MOUSE, POU domain transcription factor SCIP, POU DOMAIN, CLASS 3, TRANSCRIPTION FACTOR 1
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P21952
Length: 128
Pfam Domains: 3-73 Pou domain - N-terminal to homeobox domain
82-125 Homeobox domain
Sequence:
(in bold interface residues)
1 APSSDDLEQFAKQFKQRRIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCK 60
61 LKPLLNKWLEETDSIEVGVKGALESHFLKCPKPSAHEITGLADSLQLEKEVVRVWFCNRR 120
121 QKEKRMTP
Interface Residues: 25, 41, 42, 43, 44, 46, 47, 53, 57, 67, 71, 110, 111, 113, 114, 117, 118, 121, 122, 125
3D-footprint Homologues: 7u0g_M, 3d1n_M, 1per_L, 3l1p_A, 1o4x_A, 1au7_A, 2xsd_C, 7xrc_C, 8g87_X, 1e3o_C, 3a01_E, 5jlw_D, 2ld5_A, 1le8_A, 1ig7_A, 7q3o_C, 5zjt_E, 3rkq_B, 2r5y_A, 1fjl_B, 5hod_A, 2h1k_B, 6es3_K, 4cyc_A, 1mnm_C, 1b72_A, 7psx_B, 4xrs_G, 1puf_A, 1jgg_B, 5zfz_A, 3lnq_A, 2lkx_A, 1nk2_P, 5flv_I, 3cmy_A, 1zq3_P, 1k61_B
Binding Motifs: 2xsd_C CATGCAT
Binding Sites: 2xsd_A
2xsd_B
Publications: Jauch R, Choo S.H, Ng C.K, Kolatkar P.R. Crystal structure of the dimeric Oct6 (POU3f1) POU domain bound to palindromic MORE DNA. Proteins 79:674-7 (2011). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.