Transcription Factor

Accessions: T12706 (AthalianaCistrome v4_May2016), Q9M2D9 (JASPAR 2024)
Names: AT3G61250, MYB17, T12706;, AtMYB17, Myb-related protein 17, MYB17_ARATH, Protein LATE MERISTEM IDENTITY 2, Transcription factor MYB17
Organisms: Arabidopsis thaliana
Libraries: AthalianaCistrome v4_May2016 1, JASPAR 2024 2
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), family:MYB
Length: 299
Pfam Domains: 14-61 Myb-like DNA-binding domain
17-77 Myb-like DNA-binding domain
67-112 Myb-like DNA-binding domain
70-115 Myb-like DNA-binding domain
Sequence:
(in bold interface residues)
1 MGRTPCCDKIGLKKGPWTPEEDEVLVAHIKKNGHGSWRTLPKLAGLLRCGKSCRLRWTNY 60
61 LRPDIKRGPFTADEEKLVIQLHAILGNRWAAIAAQLPGRTDNEIKNLWNTHLKKRLLSMG 120
121 LDPRTHEPLPSYGLAKQAPSSPTTRHMAQWESARVEAEARLSRESMLFSPSFYSGVVKTE 180
181 CDHFLRIWNSEIGEAFRNLAPLDESTITSQSPCSRATSTSSALLKSSTNSWGGKEVTVAI 240
241 HGSDYSPYSNDLEDDSTDSALQLLLDFPISDDDMSFLEENIDSYSQAPPIGLVSMVSKF
Interface Residues: 14, 49, 50, 51, 52, 54, 55, 58, 59, 60, 101, 102, 105, 106, 109, 110, 111
3D-footprint Homologues: 3osg_A, 1vfc_A, 1w0t_A, 2kdz_A, 7xur_A, 5eyb_B, 6kks_A, 1mse_C, 3zqc_A
Binding Motifs: M0550 wwdwwGGTAGGTrrr
MA1766.1 yyyACCTACCwwhww
MA1766.2 yyyACCTACCw
Publications: Kelemen Z., Sebastian A., Xu W., Grain D., Salsac F., Avon A., Berger N., Tran J., Dubrecq B., Lurin C., Lepiniec L., Contreras-Moreira B., Dubos C. Analysis of the DNA-Binding Activities of the Arabidopsis R2R3-MYB Transcription Factor Family by One-Hybrid Experiments in Yeast. PLoS One 10, e0141044 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.