Transcription Factor

						

			
Accessions: KLF13_full (HumanTF 1.0)

			
Names: Basic transcription element-binding protein 3, BTE-binding protein 3, KLF13, KLF13_HUMAN, Krueppel-like factor 13, Novel Sp1-like zinc finger transcription factor 1, RANTES factor of late activated T-lymphocytes 1, RFLAT-1, Transcription factor BTEB3, Transcription factor NSLP1
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q9Y2Y9
Notes: Ensembl ID: ENSG00000169926; Full protein sequence; TF family: znfC2H2; Clone source: hORFeome
Length: 289
Pfam Domains:   167-191 C2H2-type zinc finger
  167-191 Zinc finger, C2H2 type
  183-209 Zinc-finger double domain
  197-221 Zinc finger, C2H2 type
  197-221 C2H2-type zinc finger
  214-236 Zinc-finger double domain
  227-249 Zinc finger, C2H2 type
  227-249 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 MAAAAYVDHFAAECLVSMSSRAVVHGPREGPESRPEGAAVAATPTLPRVEERRDGKDSAS   60
  61 LFVVARILADLNQQAPAPAPAERREGAAARKARTPCRLPPPAPEPTSPGAEGAAAAPPSP  120
 121 AWSEPEPEAGLEPEREPGPAGSGEPGLRQRVRRGRSRADLESPQRKHKCHYAGCEKVYGK  180
 181 SSHLKAHLRTHTGERPFACSWQDCNKKFARSDELARHYRTHTGEKKFSCPICEKRFMRSD  240
 241 HLTKHARRHANFHPGMLQRRGGGSRTGSLSDYSRSDASSPTISPASSP*
Interface Residues: 141, 142, 144, 152, 156, 175, 179, 180, 181, 182, 183, 185, 186, 188, 189, 192, 208, 209, 210, 211, 212, 213, 215, 216, 217, 220, 237, 238, 239, 240, 241, 242, 243, 244, 245, 247, 248
3D-footprint Homologues: 8ssq_A, 7w1m_H, 8ssu_A, 5kkq_D, 7n5w_A, 6jnm_A, 3uk3_C, 1tf3_A, 8cuc_F, 5ei9_F, 1g2f_F, 5kl3_A, 1ubd_C, 2kmk_A, 7ysf_A, 6ml4_A, 6blw_A, 5k5l_F, 6u9q_A, 4x9j_A, 2gli_A, 1tf6_A, 8h9h_G, 7y3m_I, 2lt7_A, 6e94_A, 6a57_A, 2jpa_A, 8gn3_A, 7y3l_A, 7txc_E, 5k5i_A, 1llm_D, 2drp_D, 1f2i_J, 2wbs_A, 4m9v_C, 5yel_A, 5yj3_D, 5v3j_F
Binding Motifs: KLF13_full rtRmCACGCCCCYTTttg
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.