Transcription Factor

Accessions: Q7L3S4 (JASPAR 2024)
Names: Mesenchymal stem cell protein DSC43, Zinc finger protein 771, ZN771_HUMAN
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q7L3S4
Length: 317
Pfam Domains: 63-85 C2H2-type zinc finger
63-81 C2H2-type zinc finger
63-85 Zinc finger, C2H2 type
78-101 Zinc-finger double domain
91-109 C2H2-type zinc finger
92-113 Zinc finger, C2H2 type
93-113 C2H2-type zinc finger
105-129 Zinc-finger double domain
118-141 C2H2-type zinc finger
119-141 C2H2-type zinc finger
119-141 Zinc finger, C2H2 type
133-157 Zinc-finger double domain
147-169 C2H2-type zinc finger
147-169 C2H2-type zinc finger
147-169 Zinc finger, C2H2 type
161-184 Zinc-finger double domain
175-197 Zinc finger, C2H2 type
175-197 C2H2-type zinc finger
175-197 C2H2-type zinc finger
190-213 Zinc-finger double domain
203-225 C2H2-type zinc finger
203-225 C2H2-type zinc finger
203-225 Zinc finger, C2H2 type
217-242 Zinc-finger double domain
230-253 C2H2-type zinc finger
231-253 C2H2-type zinc finger
231-253 Zinc finger, C2H2 type
245-268 Zinc-finger double domain
259-281 C2H2-type zinc finger
259-283 C2H2-type zinc finger
259-281 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPA 60
61 RPHACPDCGRAFARRSTLAKHARTHTGERPFGCTECGRRFSQKSALTKHGRTHTGERPYE 120
121 CPECDKRFSAASNLRQHRRRHTGEKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYACPDC 180
181 GRAFGGSSCLARHRRTHTGERPYACADCGTRFAQSSALAKHRRVHTGEKPHRCAVCGRRF 240
241 GHRSNLAEHARTHTGERPYPCAECGRRFRLSSHFIRHRRAHMRRRLYICAGCGRDFKLPP 300
301 GATAATATERCPECEGS
Interface Residues: 73, 74, 76, 77, 80, 101, 102, 103, 104, 105, 107, 108, 110, 111, 112, 114, 129, 130, 131, 132, 133, 135, 136, 140, 157, 158, 159, 160, 161, 162, 163, 164, 175, 185, 186, 187, 188, 189, 191, 192, 193, 213, 214, 215, 216, 217, 218, 220, 221, 222, 241, 242, 243, 244, 245, 247, 248, 254, 268, 270, 271, 272, 273, 275, 276, 280, 297
3D-footprint Homologues: 1tf3_A, 7y3l_A, 5v3j_F, 8ssq_A, 7w1m_H, 5k5l_F, 5yel_A, 8ssu_A, 1f2i_J, 5kkq_D, 1tf6_A, 8gn3_A, 7ysf_A, 7y3m_I, 1ubd_C, 8cuc_F, 3uk3_C, 5k5i_A, 6blw_A, 2gli_A, 2wbs_A, 5yj3_D, 7txc_E, 2lt7_A, 2jpa_A, 6ml4_A, 4x9j_A, 1g2f_F, 5kl3_A, 1llm_D, 6e94_A, 2kmk_A, 7n5w_A, 6u9q_A, 5ei9_F, 4m9v_C, 8h9h_G, 6jnm_A, 6a57_A, 2drp_D
Binding Motifs: UN0226.1 drCGCTAACCAYTry
UN0226.2 rCGCTAACCAYT
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.