Transcription Factor
| Accessions: | Q7L3S4 (JASPAR 2024) |
| Names: | Mesenchymal stem cell protein DSC43, Zinc finger protein 771, ZN771_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | JASPAR 2024 1 1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q7L3S4 |
| Length: | 317 |
| Pfam Domains: | 63-85 C2H2-type zinc finger 63-81 C2H2-type zinc finger 63-85 Zinc finger, C2H2 type 78-101 Zinc-finger double domain 91-109 C2H2-type zinc finger 92-113 Zinc finger, C2H2 type 93-113 C2H2-type zinc finger 105-129 Zinc-finger double domain 118-141 C2H2-type zinc finger 119-141 C2H2-type zinc finger 119-141 Zinc finger, C2H2 type 133-157 Zinc-finger double domain 147-169 C2H2-type zinc finger 147-169 C2H2-type zinc finger 147-169 Zinc finger, C2H2 type 161-184 Zinc-finger double domain 175-197 Zinc finger, C2H2 type 175-197 C2H2-type zinc finger 175-197 C2H2-type zinc finger 190-213 Zinc-finger double domain 203-225 C2H2-type zinc finger 203-225 C2H2-type zinc finger 203-225 Zinc finger, C2H2 type 217-242 Zinc-finger double domain 230-253 C2H2-type zinc finger 231-253 C2H2-type zinc finger 231-253 Zinc finger, C2H2 type 245-268 Zinc-finger double domain 259-281 C2H2-type zinc finger 259-283 C2H2-type zinc finger 259-281 Zinc finger, C2H2 type |
| Sequence: (in bold interface residues) | 1 MPGEQQAEEEEEEEMQEEMVLLVKGEEDEGEEKYEVVKLKIPMDNKEVPGEAPAPSADPA 60 61 RPHACPDCGRAFARRSTLAKHARTHTGERPFGCTECGRRFSQKSALTKHGRTHTGERPYE 120 121 CPECDKRFSAASNLRQHRRRHTGEKPYACAHCGRRFAQSSNYAQHLRVHTGEKPYACPDC 180 181 GRAFGGSSCLARHRRTHTGERPYACADCGTRFAQSSALAKHRRVHTGEKPHRCAVCGRRF 240 241 GHRSNLAEHARTHTGERPYPCAECGRRFRLSSHFIRHRRAHMRRRLYICAGCGRDFKLPP 300 301 GATAATATERCPECEGS |
| Interface Residues: | 73, 74, 76, 77, 80, 101, 102, 103, 104, 105, 107, 108, 110, 111, 112, 114, 129, 130, 131, 132, 133, 135, 136, 140, 157, 158, 159, 160, 161, 162, 163, 164, 175, 185, 186, 187, 188, 189, 191, 192, 193, 213, 214, 215, 216, 217, 218, 220, 221, 222, 241, 242, 243, 244, 245, 247, 248, 254, 268, 270, 271, 272, 273, 275, 276, 280, 297 |
| 3D-footprint Homologues: | 1tf3_A, 7y3l_A, 5v3j_F, 8ssq_A, 7w1m_H, 5k5l_F, 5yel_A, 8ssu_A, 1f2i_J, 5kkq_D, 1tf6_A, 8gn3_A, 7ysf_A, 7y3m_I, 1ubd_C, 8cuc_F, 3uk3_C, 5k5i_A, 6blw_A, 2gli_A, 2wbs_A, 5yj3_D, 7txc_E, 2lt7_A, 2jpa_A, 6ml4_A, 4x9j_A, 1g2f_F, 5kl3_A, 1llm_D, 6e94_A, 2kmk_A, 7n5w_A, 6u9q_A, 5ei9_F, 4m9v_C, 8h9h_G, 6jnm_A, 6a57_A, 2drp_D |
| Binding Motifs: | UN0226.1 drCGCTAACCAYTry UN0226.2 rCGCTAACCAYT |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.