Transcription Factor

						

			
Accessions: 3fyl_A (3D-footprint 20231221), 3g6p_A (3D-footprint 20231221), 3g6q_B (3D-footprint 20231221), 3g6r_B (3D-footprint 20231221), 3g9j_A (3D-footprint 20231221)

			
Names: GCR_RAT, Glucocorticoid receptor, GR, Nuclear receptor subfamily 3 group C member 1
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P06536
Length: 74
Pfam Domains:      3-70 Zinc finger, C4 type (two domains)
Sequence: 
(in bold interface residues)		   1 SHMCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR   60
  61 YRKCLQAGMNLEAR
Interface Residues: 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 3g9m_B, 1a6y_A, 1lo1_A, 4oln_B, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B
Binding Motifs: 3g9j_AB CaGnACAnnnTGtnC
3fyl_AB GnACAnnntGTaC
3g6p_A gnaCA
3g6p_AB CnGnrCAnnnTGTnC
3g6q_AB GnACAnnnTGTnC
3g6q_B AGnACA
3g6r_AB GnnCAnnnTGTnC
Binding Sites: 3g6p_C / 3g6r_D
3g6p_D / 3g6r_C
3g6q_C
3g6q_D
			
Publications: Meijsing S.H, Pufall M.A, So A.Y, Bates D.L, Chen L, Yamamoto K.R. DNA binding site sequence directs glucocorticoid receptor structure and activity. Science (New York, N.Y.) 324:407-10 (2009). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.