Transcription Factor

Accessions: 3qsv_A (3D-footprint 20231221), 3qsv_B (3D-footprint 20231221)
Names: Deletion target in pancreatic carcinoma 4 homolog, MAD homolog 4, Mothers against decapentaplegic homolog 4, Mothers against DPP homolog 4, SMAD 4, SMAD family member 4, SMAD4_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P97471
Length: 129
Pfam Domains: 28-128 MH1 domain
Sequence:
(in bold interface residues)
1 PTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPS 60
61 KCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVN 120
121 PYHYERVVS
Interface Residues: 70, 72, 74, 79, 106, 108
3D-footprint Homologues: 6fzs_A, 5nm9_A, 5od6_A, 6h3r_A, 5mey_A, 7qd4_A
Binding Motifs: 3qsv_AD GkCTAGrC
3qsv_B tAgaC
3qsv_BC GtCTAGaC
Binding Sites: 3qsv_G / 3qsv_H
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.