Transcription Factor

Accessions: 5i50_A (3D-footprint 20231221)
Names: bHLHe39, Class E basic helix-loop-helix protein 39, Myc proto-oncogene protein, MYC_HUMAN, Proto-oncogene c-Myc, Transcription factor p64
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P01106
Length: 92
Pfam Domains: 8-60 Helix-loop-helix DNA-binding domain
61-92 Myc leucine zipper domain
Sequence:
(in bold interface residues)
1 MATEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQ 60
61 AETQKLISEIDLLRKQNEQLKHKLEQLRNSCA
Interface Residues: 9, 11, 12, 13, 15, 16, 17, 19, 20, 21, 25, 45, 85, 86, 87, 88, 89
3D-footprint Homologues: 7z5k_B, 1a0a_B, 1an4_A, 1am9_A, 7rcu_E, 5gnj_I, 6g1l_A, 7ssa_L, 5i50_B, 7d8t_A, 4zpk_A, 7xi3_A, 5nj8_D, 7f2f_B, 5eyo_A, 5v0l_A, 7xq5_A, 8eb5_A, 8edg_C
Binding Motifs: 5i50_AB CCACGTGAA
Publications: Jung LA, Gebhardt A, Koelmel W, Ade CP, Walz S, Kuper J, von Eyss B, Letschert S, Redel C, d'Artista L, Biankin A, Zender L, Sauer M, Wolf E, Evan G, Kisker C, Eilers M. OmoMYC blunts promoter invasion by oncogenic MYC to inhibit gene expression characteristic of MYC-dependent tumors. Oncogene : (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.