Transcription Factor

Accessions: Q8LAT0 (JASPAR 2024), T15872 (AthalianaCistrome v4_May2016)
Names: ATB20_ARATH, HD-ZIP protein ATHB-20, Homeobox-leucine zipper protein ATHB-20, Homeodomain transcription factor ATHB-20, AT3G01220, ATHB20, T15872;
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2024 1, AthalianaCistrome v4_May2016 2
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:Homeobox
Length: 286
Pfam Domains: 89-140 Homeobox domain
142-182 Homeobox associated leucine zipper
Sequence:
(in bold interface residues)
1 MYVFDPTTEAGLRLEMAFPQHGFMFQQLHEDNSQDQLPSCPPHLFNGGGNYMMNRSMSLM 60
61 NVQEDHNQTLDEENLSDDGAHTMLGEKKKRLQLEQVKALEKSFELGNKLEPERKIQLAKA 120
121 LGMQPRQIAIWFQNRRARWKTRQLERDYDSLKKQFESLKSDNASLLAYNKKLLAEVMALK 180
181 NKECNEGNIVKREAEASWSNNGSTENSSDINLEMPRETITTHVNTIKDLFPSSIRSSAHD 240
241 DDHHQNHEIVQEESLCNMFNGIDETTPAGYWAWSDPNHNHHHHQFN
Interface Residues: 87, 88, 89, 90, 91, 126, 127, 129, 130, 133, 134, 136, 137, 138, 140, 141, 152, 155
3D-footprint Homologues: 3cmy_A, 8ejp_B, 6a8r_A, 2ld5_A, 1nk2_P, 3rkq_B, 1au7_A, 5hod_A, 7psx_B, 5jlw_D, 8ik5_C, 1e3o_C, 7q3o_C, 1le8_A, 8osb_E, 1ig7_A, 6es3_K, 4xrs_G, 2r5y_A, 1puf_A, 5zfz_A, 5flv_I, 3a01_E, 1puf_B, 1fjl_B, 5zjt_E, 4cyc_A, 8pmf_A, 1b72_A, 6wig_A, 1zq3_P, 8eml_B, 4qtr_D, 2lkx_A, 1o4x_A, 9b8u_A, 1du0_A, 3lnq_A, 2hdd_A, 1jgg_B, 2hos_A, 6m3d_C
Binding Motifs: M0443 / MA1209.1 hyAATAATTra
M0431 tyAATKATTrr
MA1209.2 yAATAATT
Publications: Johannesson H., Wang Y., Engstrom P. DNA-binding and dimerization preferences of Arabidopsis homeodomain-leucine zipper transcription factors in vitro. Plant Mol. Biol. 45:63-73 (2001). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.