Transcription Factor
| Accessions: | Carub.0005s0095.1.p (EEADannot 2026-03-04) |
| Names: | BPC1 |
| Organisms: | Capsella rubella |
| Libraries: | EEADannot 2026-03-04 1 1 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed] |
| Notes: | family:BBR/BPC |
| Length: | 200 |
| Pfam Domains: | 19-200 GAGA binding protein-like family |
| Sequence: | MMMDFAIGDTMSQRLLRSKMMHQPVVNTSRFEENPAPPPREDEIVQPSKKRKMRGSISSP TVPKAKKPRKPKEESGATNNVHQQRVKPAKKSVDLVINGVSMDISGLPVPVCTCTGTPQQ CYRWGCGGWQSACCTTNISMYPLPMSTKRRGARISGRKMSQGAFKKVLEKLATEGYSFGN SIDLKSHWARHGTNKFVTIR |
| Binding Motifs: | EEAD0614 GAGAGAGArAr |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.