Transcription Factor

						

			
Accessions: Carub.0005s0095.1.p (EEADannot 2026-03-04)

			
Names: BPC1
Organisms: Capsella rubella
Libraries: EEADannot 2026-03-04 1
1 Contreras-Moreira B, Sebastian A. FootprintDB: Analysis of Plant Cis-Regulatory Elements, Transcription Factors, and Binding Interfaces. Methods Mol Biol 1482:259-77 (2016) [Pubmed]
Notes: family:BBR/BPC
Length: 200
Pfam Domains:    19-200 GAGA binding protein-like family
Sequence: MMMDFAIGDTMSQRLLRSKMMHQPVVNTSRFEENPAPPPREDEIVQPSKKRKMRGSISSP
TVPKAKKPRKPKEESGATNNVHQQRVKPAKKSVDLVINGVSMDISGLPVPVCTCTGTPQQ
CYRWGCGGWQSACCTTNISMYPLPMSTKRRGARISGRKMSQGAFKKVLEKLATEGYSFGN
SIDLKSHWARHGTNKFVTIR
Binding Motifs: EEAD0614 GAGAGAGArAr
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.