Transcription Factor
| Accessions: | 1by4_C (3D-footprint 20260701), 6xwh_D (3D-footprint 20260701) |
| Names: | Nuclear receptor subfamily 2 group B member 1, RETINOIC ACID RECEPTOR RXR-ALPHA, Retinoid X receptor alpha, RXRA_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P19793 |
| Length: | 78 |
| Pfam Domains: | 3-71 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCR 60 61 YQKCLAMGMKREAVQEER |
| Interface Residues: | 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54, 76, 78 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 4tnt_B, 5e69_A, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E |
| Binding Motifs: | 1by4_BC GGTCAnnnGGTCA 6xwh_CD GGTCAnGGCCA |
| Binding Sites: | 1by4_E / 1by4_G 1by4_F / 1by4_H 6xwh_A 6xwh_B |
| Publications: | Zhao Q, Chasse S.A, Devarakonda S, Sierk M.L, Ahvazi B, Rastinejad F. Structural basis of RXR-DNA interactions. Journal of molecular biology 296:509-20 (2000). [Pubmed] Osz J, McEwen AG, Bourguet M, Przybilla F, Peluso-Iltis C, Poussin-Courmontagne P, Mély Y, Cianférani S, Jeffries CM, Svergun DI, Rochel N. Structural basis for DNA recognition and allosteric control of the retinoic acid receptors RAR-RXR. Nucleic Acids Res 48:9969-9985 (2020). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.