Transcription Factor

Accessions: PAX2_DBD (HumanTF 1.0), PAX2 (HT-SELEX2 May2017)
Names: PAX2, PAX2_HUMAN, ENSG00000075891
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q02962
Notes: Ensembl ID: ENSG00000075891; DNA-binding domain sequence; TF family: PAX; Clone source: Gene synthesis, TF family: PAX experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: PAX experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 293
Pfam Domains: 15-139 'Paired box' domain
Sequence:
(in bold interface residues)
1 DMHCKADPFSAMHPGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVS 60
61 HGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVDKIAEYKRQNPTMFAWEIRDRLLAE 120
121 GICDNDTVPSVSSINRIIRTKVQQPFHPTPDGAGTGVTAPGHTIVPSTASPPVSSASNDP 180
181 VGSYSINGILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQ 240
241 SGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLP
Interface Residues: 28, 60, 61, 63, 65, 66, 82, 85, 88, 130, 131, 132, 133, 135, 136, 139
3D-footprint Homologues: 6pax_A, 1k78_A, 1pdn_C
Binding Motifs: PAX2_DBD sGTCACGCwTsRsTGmky
PAX2_2 ccGtCACGCwysrsyrcsym
PAX2_methyl_1 ysGTCACGCwTsAsyGmwya
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.