Transcription Factor
| Accessions: | 1au7_B (3D-footprint 20231221) |
| Names: | GHF-1, Growth hormone factor 1, PIT1_RAT, Pituitary-specific positive transcription factor 1, PROTEIN PIT-1 |
| Organisms: | Rattus norvegicus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P10037 |
| Length: | 128 |
| Pfam Domains: | 3-70 Pou domain - N-terminal to homeobox domain 71-126 Homeobox domain |
| Sequence: (in bold interface residues) | 1 GMRALEQFANEFKVRRIKLGYTQTNVGEALAAVHGSEFSQTTICRFENLQLSFKNACKLK 60 61 AILSKWLEEAKRRTTISIAAKDALERHFGEHSKPSSQEIMRMAEELNLEKEVVRVWFCNR 120 121 RQREKRVK |
| Interface Residues: | 23, 39, 40, 41, 42, 44, 45, 47, 48, 51, 55, 71, 72, 73, 111, 112, 114, 115, 118, 119, 122, 123, 126 |
| 3D-footprint Homologues: | 3d1n_M, 7u0g_M, 3l1p_A, 8g87_X, 1e3o_C, 1au7_A, 2xsd_C, 1o4x_A, 7xrc_C, 2d5v_B, 2lkx_A, 1nk2_P, 6m3d_C, 2r5y_A, 6a8r_A, 3cmy_A, 2hdd_A, 3rkq_B, 1fjl_B, 4xrs_G, 2hos_A, 1b72_A, 5zfz_A, 1ig7_A, 5flv_I, 5zjt_E, 2h1k_B, 1jgg_B, 7psx_B, 5hod_A, 3lnq_A, 5jlw_D, 2ld5_A, 1le8_A, 7q3o_C, 1puf_A, 4xrm_B, 1zq3_P, 6es3_K, 4cyc_A, 1du0_A, 4qtr_D, 3a01_E |
| Binding Motifs: | 1au7_AB tcATGTATATACAT |
| Binding Sites: | 1au7_C 1au7_D |
| Publications: | Jacobson E.M, Li P, Leon-del-Rio A, Rosenfeld M.G, Aggarwal A.K. Structure of Pit-1 POU domain bound to DNA as a dimer: unexpected arrangement and flexibility. Genes & development 11:198-212 (1997). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.