Transcription Factor

						

			
Accessions: ZNF274 (HT-SELEX2 May2017)

			
Names: ENSG00000171606, ZNF274
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: KRAB_SCAN_Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 3, TF family: KRAB_SCAN_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 3
Length: 167
Pfam Domains:     22-32 C2H2-type zinc finger
    22-43 Zinc finger, C2H2 type
    36-59 Zinc-finger double domain
    49-72 C2H2-type zinc finger
    49-71 C2H2-type zinc finger
    49-71 Zinc finger, C2H2 type
    63-87 Zinc-finger double domain
    76-99 C2H2-type zinc finger
    77-99 C2H2-type zinc finger
    77-99 Zinc finger, C2H2 type
   93-115 Zinc-finger double domain
  104-127 C2H2-type zinc finger
  105-127 C2H2-type zinc finger
  105-127 Zinc finger, C2H2 type
  119-144 Zinc-finger double domain
  133-155 Zinc finger, C2H2 type
  133-156 C2H2-type zinc finger
  133-156 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 TFSRSTKQITFIRIHKGSQVCRCSECGKIFRNPRYFSVHKKIHTGERPYVCQDCGKGFVQ   60
  61 SSSLTQHQRVHSGERPFECQECGRTFNDRSAISQHLRTHTGAKPYKCQDCGKAFRQSSHL  120
 121 IRHQRTHTGERPYACNKCGKAFTQSSHLIGHQRTHNRTKRKKKQPTS
Interface Residues: 4, 5, 6, 31, 32, 34, 35, 38, 40, 49, 59, 60, 61, 62, 63, 65, 66, 67, 68, 69, 70, 72, 87, 88, 89, 90, 91, 92, 93, 94, 95, 98, 115, 116, 117, 118, 119, 121, 122, 143, 144, 145, 146, 147, 148, 149, 150, 153, 154
3D-footprint Homologues: 5v3j_F, 7w1m_H, 3uk3_C, 5k5i_A, 6u9q_A, 1tf6_A, 1ubd_C, 2kmk_A, 6jnm_A, 6ml4_A, 8ssq_A, 6blw_A, 5yel_A, 4x9j_A, 8ssu_A, 2gli_A, 1f2i_J, 5kkq_D, 5ei9_F, 1g2f_F, 4m9v_C, 7ysf_A, 6e94_A, 6a57_A, 2jpa_A, 1tf3_A, 7n5w_A, 5k5l_F, 8gn3_A, 5kl3_A, 8h9h_G, 2lt7_A, 8cuc_F, 7y3l_A, 1llm_D, 2drp_D, 2wbs_A, 7txc_E, 7y3m_I, 5yj3_D
Binding Motifs: ZNF274_2 rryrTGAGTyCTCgyk
ZNF274_methyl_1 wrTrTGAGTYCTCryt
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.