Transcription Factor

Accessions: CG8319 (FlyZincFinger 1.0 )
Names: CG8319
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 232
Pfam Domains: 4-28 C2H2-type zinc finger
5-27 C2H2-type zinc finger
5-27 Zinc finger, C2H2 type
60-78 C2H2-type zinc finger
60-78 C2H2-type zinc finger
88-106 C2H2-type zinc finger
88-110 C2H2-type zinc finger
88-110 Zinc finger, C2H2 type
120-142 C2H2-type zinc finger
134-153 Zinc-finger double domain
148-170 C2H2-type zinc finger
162-186 Zinc-finger double domain
176-198 C2H2-type zinc finger
176-199 C2H2-type zinc finger
176-198 Zinc finger, C2H2 type
190-213 Zinc-finger double domain
203-214 C2H2-type zinc finger
204-224 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 KNQTFKCELCIKQFKRQINLLDHMKVHSNSHVCQNCEERFLFKADLDNHQCYRNSNSTVE 60
61 CPECLKVFSSTQSLDSHKCKDMQERSPFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPH 120
121 KCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPH 180
181 CPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHHLKRHFLGKHRDGDQ
Interface Residues: 16, 18, 19, 22, 41, 42, 43, 44, 45, 48, 70, 71, 72, 73, 75, 76, 80, 98, 99, 101, 102, 105, 106, 109, 130, 131, 132, 133, 134, 136, 137, 139, 140, 141, 143, 158, 159, 160, 161, 162, 164, 165, 166, 169, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 197, 200, 201, 214, 215, 216, 217, 218, 220, 221
3D-footprint Homologues: 8ssu_A, 5v3j_F, 7w1m_H, 8ssq_A, 2drp_D, 1tf6_A, 5yel_A, 5k5l_F, 7n5w_A, 6jnm_A, 5kkq_D, 5ei9_F, 5kl3_A, 5k5i_A, 2kmk_A, 6ml4_A, 2gli_A, 8h9h_G, 6e94_A, 7y3m_I, 7ysf_A, 6a57_A, 2jpa_A, 1ubd_C, 7y3l_A, 3uk3_C, 1tf3_A, 8cuc_F, 1g2f_F, 2wbs_A, 1llm_D, 7txc_E, 1f2i_J, 6blw_A, 6u9q_A, 4x9j_A, 4m9v_C, 2lt7_A, 5yj3_D, 8gn3_A, 8gh6_A, 1yuj_A
Binding Motifs: CG8319_SANGER_2.5_FBgn0037722 rGGTCACC
CG8319_SOLEXA_2.5_FBgn0037722 grGGTCACCac
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.