Transcription Factor
| Accessions: | CG8319 (FlyZincFinger 1.0 ) |
| Names: | CG8319 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 232 |
| Pfam Domains: | 4-28 C2H2-type zinc finger 5-27 C2H2-type zinc finger 5-27 Zinc finger, C2H2 type 60-78 C2H2-type zinc finger 60-78 C2H2-type zinc finger 88-106 C2H2-type zinc finger 88-110 C2H2-type zinc finger 88-110 Zinc finger, C2H2 type 120-142 C2H2-type zinc finger 134-153 Zinc-finger double domain 148-170 C2H2-type zinc finger 162-186 Zinc-finger double domain 176-198 C2H2-type zinc finger 176-199 C2H2-type zinc finger 176-198 Zinc finger, C2H2 type 190-213 Zinc-finger double domain 203-214 C2H2-type zinc finger 204-224 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 KNQTFKCELCIKQFKRQINLLDHMKVHSNSHVCQNCEERFLFKADLDNHQCYRNSNSTVE 60 61 CPECLKVFSSTQSLDSHKCKDMQERSPFQCPHCQQAFTREQNLKAHLLIHAESKQGNGPH 120 121 KCSYCQTGFFNKSALKVHIHAHMGERPHACPFCVSNFRSKQALKVHIRIHTGEKPYQCPH 180 181 CPKTFSDNNNLAKHRRRHSDERPYKCSICLQDFREKHHLKRHFLGKHRDGDQ |
| Interface Residues: | 16, 18, 19, 22, 41, 42, 43, 44, 45, 48, 70, 71, 72, 73, 75, 76, 80, 98, 99, 101, 102, 105, 106, 109, 130, 131, 132, 133, 134, 136, 137, 139, 140, 141, 143, 158, 159, 160, 161, 162, 164, 165, 166, 169, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 197, 200, 201, 214, 215, 216, 217, 218, 220, 221 |
| 3D-footprint Homologues: | 8ssu_A, 5v3j_F, 7w1m_H, 8ssq_A, 2drp_D, 1tf6_A, 5yel_A, 5k5l_F, 7n5w_A, 6jnm_A, 5kkq_D, 5ei9_F, 5kl3_A, 5k5i_A, 2kmk_A, 6ml4_A, 2gli_A, 8h9h_G, 6e94_A, 7y3m_I, 7ysf_A, 6a57_A, 2jpa_A, 1ubd_C, 7y3l_A, 3uk3_C, 1tf3_A, 8cuc_F, 1g2f_F, 2wbs_A, 1llm_D, 7txc_E, 1f2i_J, 6blw_A, 6u9q_A, 4x9j_A, 4m9v_C, 2lt7_A, 5yj3_D, 8gn3_A, 8gh6_A, 1yuj_A |
| Binding Motifs: | CG8319_SANGER_2.5_FBgn0037722 rGGTCACC CG8319_SOLEXA_2.5_FBgn0037722 grGGTCACCac |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.