Transcription Factor

						

			
Accessions: RARA_DBD (HumanTF 1.0)

			
Names: PML-RARA-regulated adapter molecule 1, PRAM_HUMAN, PRAM-1, RARA
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q96QH2
Notes: Ensembl ID: ENSG00000131759; DNA-binding domain sequence; TF family: Nuclear_Receptor; Clone source: MGC
Length: 112
Pfam Domains:     22-90 Zinc finger, C4 type (two domains)
Sequence: 
(in bold interface residues)		   1 MASEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCH   60
  61 RDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSES
Interface Residues: 31, 32, 34, 35, 41, 42, 43, 44, 45, 47, 48, 49, 52, 54, 58, 73, 77, 79, 81, 83, 86, 88, 90, 94, 95, 97, 99, 102
3D-footprint Homologues: 6fbq_A, 7wnh_D, 6l6q_B, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2nll_B, 1lat_A, 2ff0_A, 1dsz_A, 8hbm_B, 4umm_E, 3cbb_A, 7xv6_B, 4iqr_B, 2han_A, 1hcq_E, 7xvn_C, 2han_B, 1kb2_B, 2a66_A, 8cef_H, 5krb_G, 4yhx_A, 5cbz_E, 4hn5_B, 5e69_A, 8rm6_A, 3g6t_A, 1r4i_A, 5emc_A, 7prw_B, 5cbx_B, 4tnt_B
Binding Motifs: RARA_DBD_1 aRAGGTCAtkwrrGGTCA
RARA_DBD_2 rAGGTCAAAAGGTCAAkk
RARA_DBD_3 AGGTCAysyaRAGGTCA
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.