Transcription Factor

						

			
Accessions: SNAI2_DBD (HumanTF 1.0)

			
Names: Neural crest transcription factor Slug, Protein snail homolog 2, SNAI2, SNAI2_HUMAN, Zinc finger protein SNAI2
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: O43623
Notes: Ensembl ID: ENSG00000019549; DNA-binding domain sequence; TF family: znfC2H2; Clone source: MGC
Length: 160
Pfam Domains:     20-44 C2H2-type zinc finger
    20-42 Zinc finger, C2H2 type
    20-41 C2H2-type zinc finger
    51-73 C2H2-type zinc finger
    51-73 C2H2-type zinc finger
    51-73 Zinc finger, C2H2 type
    65-88 Zinc-finger double domain
    78-99 Zinc finger, C2H2 type
    78-99 C2H2-type zinc finger
    79-99 C2H2-type zinc finger
   92-115 Zinc-finger double domain
  105-127 Zinc finger, C2H2 type
  105-127 C2H2-type zinc finger
  105-125 Zinc-finger of C2H2 type
  105-127 C2H2-type zinc finger
  119-144 Zinc-finger double domain
  133-149 C2H2-type zinc finger
  133-154 Zinc finger, C2H2 type
  133-153 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 MAERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEY   60
  61 VSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNL  120
 121 RAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
Interface Residues: 30, 31, 33, 34, 37, 41, 61, 62, 63, 64, 65, 67, 68, 70, 71, 74, 87, 88, 89, 90, 91, 93, 94, 95, 115, 116, 117, 118, 119, 120, 121, 122, 123, 126, 143, 144, 145, 146, 147, 149, 150
3D-footprint Homologues: 7w1m_H, 8ssq_A, 5kkq_D, 8ssu_A, 5yel_A, 6wmi_A, 2i13_A, 8gh6_A, 1ubd_C, 7n5w_A, 6jnm_A, 1g2f_F, 6ml4_A, 4x9j_A, 6blw_A, 5ei9_F, 5kl3_A, 5und_A, 7eyi_G, 8h9h_G, 6e94_A, 7ysf_A, 2gli_A, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 3uk3_C, 1tf3_A, 1tf6_A, 5v3j_F, 1llm_D, 2wbs_A, 6u9q_A, 1mey_C, 7txc_E, 1f2i_J, 5k5i_A, 2kmk_A, 4m9v_C, 2lt7_A, 7y3m_I, 5k5l_F, 8gn3_A, 2drp_D, 5yj3_D
Binding Motifs: SNAI2_DBD rrCAGGTGy
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.