Transcription Factor
Accessions: | SNAI2_DBD (HumanTF 1.0) |
Names: | Neural crest transcription factor Slug, Protein snail homolog 2, SNAI2, SNAI2_HUMAN, Zinc finger protein SNAI2 |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
Uniprot: | O43623 |
Notes: | Ensembl ID: ENSG00000019549; DNA-binding domain sequence; TF family: znfC2H2; Clone source: MGC |
Length: | 160 |
Pfam Domains: | 20-44 C2H2-type zinc finger 20-42 Zinc finger, C2H2 type 20-41 C2H2-type zinc finger 51-73 C2H2-type zinc finger 51-73 C2H2-type zinc finger 51-73 Zinc finger, C2H2 type 65-88 Zinc-finger double domain 78-99 Zinc finger, C2H2 type 78-99 C2H2-type zinc finger 79-99 C2H2-type zinc finger 92-115 Zinc-finger double domain 105-127 Zinc finger, C2H2 type 105-127 C2H2-type zinc finger 105-125 Zinc-finger of C2H2 type 105-127 C2H2-type zinc finger 119-144 Zinc-finger double domain 133-149 C2H2-type zinc finger 133-154 Zinc finger, C2H2 type 133-153 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 MAERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEY 60 61 VSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNL 120 121 RAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH |
Interface Residues: | 30, 31, 33, 34, 37, 41, 61, 62, 63, 64, 65, 67, 68, 70, 71, 74, 87, 88, 89, 90, 91, 93, 94, 95, 115, 116, 117, 118, 119, 120, 121, 122, 123, 126, 143, 144, 145, 146, 147, 149, 150 |
3D-footprint Homologues: | 7w1m_H, 8ssq_A, 5kkq_D, 8ssu_A, 5yel_A, 6wmi_A, 2i13_A, 8gh6_A, 1ubd_C, 7n5w_A, 6jnm_A, 1g2f_F, 6ml4_A, 4x9j_A, 6blw_A, 5ei9_F, 5kl3_A, 5und_A, 7eyi_G, 8h9h_G, 6e94_A, 7ysf_A, 2gli_A, 6a57_A, 2jpa_A, 8cuc_F, 7y3l_A, 3uk3_C, 1tf3_A, 1tf6_A, 5v3j_F, 1llm_D, 2wbs_A, 6u9q_A, 1mey_C, 7txc_E, 1f2i_J, 5k5i_A, 2kmk_A, 4m9v_C, 2lt7_A, 7y3m_I, 5k5l_F, 8gn3_A, 2drp_D, 5yj3_D |
Binding Motifs: | SNAI2_DBD rrCAGGTGy |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.