Transcription Factor

Accessions: SNAI2_DBD (HumanTF 1.0)
Names: Neural crest transcription factor Slug, Protein snail homolog 2, SNAI2, SNAI2_HUMAN, Zinc finger protein SNAI2
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: O43623
Notes: Ensembl ID: ENSG00000019549; DNA-binding domain sequence; TF family: znfC2H2; Clone source: MGC
Length: 160
Pfam Domains: 20-42 Zinc finger, C2H2 type
20-41 C2H2-type zinc finger
20-44 C2H2-type zinc finger
51-73 C2H2-type zinc finger
51-73 Zinc finger, C2H2 type
51-73 C2H2-type zinc finger
65-88 Zinc-finger double domain
78-99 Zinc finger, C2H2 type
78-99 C2H2-type zinc finger
79-99 C2H2-type zinc finger
92-115 Zinc-finger double domain
105-127 C2H2-type zinc finger
105-127 Zinc finger, C2H2 type
105-127 C2H2-type zinc finger
105-125 Zinc-finger of C2H2 type
119-144 Zinc-finger double domain
133-149 C2H2-type zinc finger
133-154 Zinc finger, C2H2 type
133-153 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MAERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEY 60
61 VSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNL 120
121 RAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH
Interface Residues: 30, 31, 33, 34, 37, 41, 61, 62, 63, 64, 65, 67, 68, 70, 71, 74, 87, 88, 89, 90, 91, 93, 94, 102, 115, 116, 117, 118, 119, 121, 122, 126, 143, 144, 145, 146, 147, 149, 150
3D-footprint Homologues: 7w1m_H, 8ssq_A, 8ssu_A, 8gh6_A, 1ubd_C, 7n5w_A, 8h9h_G, 7ysf_A, 6e94_A, 2gli_A, 2jpa_A, 1tf3_A, 8cuc_F, 7y3l_A, 2kmk_A, 6u9q_A, 1tf6_A, 5v3j_F, 7txc_E, 2lt7_A, 7y3m_I, 1yuj_A, 2drp_D, 8gn3_A
Binding Motifs: SNAI2_DBD rrCAGGTGy
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.