Transcription Factor

						

			
Accessions: ZBTB7A_DBD (HumanTF 1.0)

			
Names: Q8TB76_HUMAN, ZBTB7A, ZBTB7A protein, Zinc finger and BTB domain containing 7A, isoform CRA_a
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: Q8TB76
Notes: Ensembl ID: ENSG00000178951; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Megaman
Length: 156
Pfam Domains:     20-41 C2H2-type zinc finger
    36-58 Zinc-finger double domain
    47-69 C2H2-type zinc finger
    47-69 Zinc finger, C2H2 type
    62-86 Zinc-finger double domain
    75-97 C2H2-type zinc finger
    75-97 Zinc finger, C2H2 type
   89-113 Zinc-finger double domain
  103-124 C2H2-type zinc finger
  103-124 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 MAPAWSQKVEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQD   60
  61 KLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHR  120
 121 HLKKDGCNGVPSRRGRKPRVRGGAPDPSPGATATPG
Interface Residues: 12, 15, 16, 29, 30, 31, 32, 33, 35, 36, 38, 39, 40, 42, 57, 58, 59, 60, 61, 63, 64, 68, 85, 86, 87, 88, 89, 91, 92, 93, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 124, 127, 130, 131, 132, 133, 134, 136
3D-footprint Homologues: 1fiu_B, 1yuj_A, 7n5w_A, 3uk3_C, 8cuc_F, 7y3l_A, 6ml4_A, 5v3j_F, 4x9j_A, 6blw_A, 5kkq_D, 1g2f_F, 6u9q_A, 5yel_A, 5ei9_F, 2kmk_A, 5k5i_A, 8ssq_A, 7w1m_H, 1f2i_J, 5und_A, 8ssu_A, 8h9h_G, 7eyi_G, 7y3m_I, 1tf6_A, 6e94_A, 7ysf_A, 6wmi_A, 2lt7_A, 2i13_A, 6a57_A, 2jpa_A, 1ubd_C, 1tf3_A, 6jnm_A, 7txc_E, 5kl3_A, 2gli_A, 1llm_D, 1mey_C, 5k5l_F, 8gn3_A, 2drp_D, 5yj3_D, 2wbs_A, 4m9v_C, 3vw4_A
Binding Motifs: ZBTB7A_DBD ggCGACCACCga
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.