Transcription Factor
| Accessions: | 2i13_A (3D-footprint 20250804) |
| Names: | Aart, Zfp-29, Zinc finger and SCAN domain-containing protein 2, Zinc finger protein 29, ZSCA2_MOUSE |
| Organisms: | Mus musculus |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q07230 |
| Length: | 151 |
| Pfam Domains: | 6-27 Zinc-finger double domain 16-39 C2H2-type zinc finger 17-39 Zinc finger, C2H2 type 17-39 C2H2-type zinc finger 31-55 Zinc-finger double domain 44-67 C2H2-type zinc finger 45-67 Zinc finger, C2H2 type 45-67 C2H2-type zinc finger 59-83 Zinc-finger double domain 73-95 C2H2-type zinc finger 73-95 Zinc finger, C2H2 type 73-95 C2H2-type zinc finger 87-112 Zinc-finger double domain 100-123 C2H2-type zinc finger 101-123 Zinc finger, C2H2 type 101-123 C2H2-type zinc finger 118-140 Zinc-finger double domain 128-151 C2H2-type zinc finger 129-151 Zinc finger, C2H2 type 129-151 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 FSRSDHLAEHQRTHKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANL 60 61 RAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQ 120 121 RTHTGEKPYKCPECGKSFSRRDALNVHQRTH |
| Interface Residues: | 3, 5, 6, 9, 27, 28, 29, 30, 31, 34, 35, 45, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 68, 83, 84, 85, 86, 87, 89, 90, 93, 111, 112, 113, 114, 115, 116, 117, 118, 121, 139, 140, 141, 142, 143, 145, 146 |
| 3D-footprint Homologues: | 5v3j_F, 7w1m_H, 5yel_A, 8cuc_F, 7y3l_A, 7n5w_A, 6jnm_A, 3uk3_C, 6u9q_A, 8ssu_A, 5kkq_D, 1tf6_A, 8gn3_A, 5ei9_F, 8ssq_A, 5k5l_F, 8h9h_G, 4m9v_C, 6e94_A, 7y3m_I, 7ysf_A, 6a57_A, 1ubd_C, 2kmk_A, 1tf3_A, 2gli_A, 1g2f_F, 7txc_E, 5k5i_A, 6ml4_A, 2jpa_A, 4x9j_A, 1f2i_J, 5yj3_D, 5kl3_A, 2drp_D, 6blw_A, 2lt7_A, 2wbs_A, 1llm_D |
| Binding Motifs: | 2i13_A CCCGGGCTTTTCCCTACA |
| Binding Sites: | 2i13_C 2i13_D |
| Publications: | Segal D.J, Crotty J.W, Bhakta M.S, Barbas C.F, Horton N.C. Structure of Aart, a designed six-finger zinc finger peptide, bound to DNA. Journal of molecular biology 363:405-21 (2006). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.