Transcription Factor

Accessions: 2i13_A (3D-footprint 20260701)
Names: Aart, Zfp-29, Zinc finger and SCAN domain-containing protein 2, Zinc finger protein 29, ZSCA2_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q07230
Length: 151
Pfam Domains: 6-27 Zinc-finger double domain
16-39 C2H2-type zinc finger
17-39 C2H2-type zinc finger
17-39 Zinc finger, C2H2 type
31-55 Zinc-finger double domain
44-67 C2H2-type zinc finger
45-67 Zinc finger, C2H2 type
45-67 C2H2-type zinc finger
59-83 Zinc-finger double domain
73-95 C2H2-type zinc finger
73-95 Zinc finger, C2H2 type
73-95 C2H2-type zinc finger
87-112 Zinc-finger double domain
100-123 C2H2-type zinc finger
101-123 Zinc finger, C2H2 type
101-123 C2H2-type zinc finger
118-140 Zinc-finger double domain
128-151 C2H2-type zinc finger
129-151 Zinc finger, C2H2 type
129-151 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 FSRSDHLAEHQRTHKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANL 60
61 RAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQ 120
121 RTHTGEKPYKCPECGKSFSRRDALNVHQRTH
Interface Residues: 3, 5, 6, 9, 27, 28, 29, 30, 31, 34, 35, 45, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 68, 83, 84, 85, 86, 87, 89, 90, 93, 111, 112, 113, 114, 115, 116, 117, 118, 121, 139, 140, 141, 142, 143, 145, 146
3D-footprint Homologues: 5v3j_F, 7w1m_H, 5yel_A, 7n5w_A, 6jnm_A, 3uk3_C, 8cuc_F, 7y3l_A, 5kkq_D, 1tf6_A, 8gn3_A, 5ei9_F, 8ssq_A, 5k5l_F, 6u9q_A, 8ssu_A, 8h9h_G, 4m9v_C, 6e94_A, 7y3m_I, 7ysf_A, 6a57_A, 1ubd_C, 2kmk_A, 1tf3_A, 1g2f_F, 7txc_E, 5k5i_A, 6ml4_A, 2gli_A, 2jpa_A, 5yj3_D, 5kl3_A, 2drp_D, 6blw_A, 4x9j_A, 1f2i_J, 2lt7_A, 2wbs_A, 1llm_D
Binding Motifs: 2i13_A CCCGGGCTTTTCCCTACA
Binding Sites: 2i13_C
2i13_D
Publications: Segal D.J, Crotty J.W, Bhakta M.S, Barbas C.F, Horton N.C. Structure of Aart, a designed six-finger zinc finger peptide, bound to DNA. Journal of molecular biology 363:405-21 (2006). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.