Transcription Factor

						

			
Accessions: 2i13_A (3D-footprint 20231221)

			
Names: Aart, Zfp-29, Zinc finger and SCAN domain-containing protein 2, Zinc finger protein 29, ZSCA2_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q07230
Length: 151
Pfam Domains:      6-27 Zinc-finger double domain
    16-39 C2H2-type zinc finger
    17-39 Zinc finger, C2H2 type
    17-39 C2H2-type zinc finger
    31-55 Zinc-finger double domain
    44-67 C2H2-type zinc finger
    45-67 Zinc finger, C2H2 type
    45-67 C2H2-type zinc finger
    59-83 Zinc-finger double domain
    73-95 C2H2-type zinc finger
    73-95 C2H2-type zinc finger
    73-95 Zinc finger, C2H2 type
   87-112 Zinc-finger double domain
  100-123 C2H2-type zinc finger
  101-123 C2H2-type zinc finger
  101-123 Zinc finger, C2H2 type
  118-140 Zinc-finger double domain
  128-151 C2H2-type zinc finger
  129-151 Zinc finger, C2H2 type
  129-151 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 FSRSDHLAEHQRTHKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANL   60
  61 RAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQ  120
 121 RTHTGEKPYKCPECGKSFSRRDALNVHQRTH
Interface Residues: 3, 5, 6, 9, 27, 28, 29, 30, 31, 34, 35, 45, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 68, 83, 84, 85, 86, 87, 89, 90, 93, 111, 112, 113, 114, 115, 116, 117, 118, 121, 139, 140, 141, 142, 143, 145, 146
3D-footprint Homologues: 5v3j_F, 2i13_A, 7w1m_H, 5yel_A, 7y3l_A, 7n5w_A, 3uk3_C, 6jnm_A, 8cuc_F, 1tf6_A, 8gn3_A, 5kkq_D, 6u9q_A, 5ei9_F, 6wmi_A, 8ssq_A, 5und_A, 5k5l_F, 8ssu_A, 8h9h_G, 4m9v_C, 7eyi_G, 7y3m_I, 6e94_A, 7ysf_A, 6a57_A, 1ubd_C, 2kmk_A, 1tf3_A, 6ml4_A, 1mey_C, 7txc_E, 5k5i_A, 2gli_A, 1g2f_F, 2jpa_A, 4x9j_A, 6blw_A, 5kl3_A, 2drp_D, 1f2i_J, 5yj3_D, 2lt7_A, 1llm_D, 2wbs_A
Binding Motifs: 2i13_A CCCGGGCTTTTCCCTACA
Binding Sites: 2i13_C
2i13_D
			
Publications: Segal D.J, Crotty J.W, Bhakta M.S, Barbas C.F, Horton N.C. Structure of Aart, a designed six-finger zinc finger peptide, bound to DNA. Journal of molecular biology 363:405-21 (2006). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.