Transcription Factor
| Accessions: | HOXD9 (HT-SELEX2 May2017) |
| Names: | ENSG00000128709, HOXD9 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 110 |
| Pfam Domains: | 44-100 Homeobox domain |
| Sequence: (in bold interface residues) | 1 SACSDHPIPGCSLKEEEKQHSQPQQQQLDPNNPEANWIHARSTRKKRCPYTKYQTLELEK 60 61 EFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSKEKCPKGD |
| Interface Residues: | 44, 45, 46, 47, 85, 86, 88, 89, 92, 93, 96, 97, 100 |
| 3D-footprint Homologues: | 1ig7_A, 6a8r_A, 2h1k_B, 1puf_A, 3cmy_A, 5zfz_A, 1fjl_B, 6m3d_C, 3d1n_M, 1zq3_P, 2lkx_A, 1nk2_P, 2ld5_A, 7q3o_C, 6es3_K, 7psx_B, 3a01_E, 1jgg_B, 5jlw_D, 3lnq_A, 4xrs_G, 2hdd_A, 3rkq_B, 2r5y_A, 1puf_B, 5flv_I, 2hos_A, 1b72_A, 5zjt_E, 4cyc_A, 2xsd_C, 1e3o_C, 1le8_A, 7xrc_C, 1au7_A, 5hod_A, 3l1p_A, 1o4x_A, 1du0_A, 4qtr_D, 8g87_X |
| Binding Motifs: | HOXD9_3 GymATAAAAm HOXD9_4 rTCRTAAAah HOXD9_7 gTCGTAAAay HOXD9_8 GymATAAAAh HOXD9_methyl_1 RTCGTAAAac HOXD9_methyl_2 GymATwAAac HOXD9_methyl_5 rTCGTAAAay HOXD9_methyl_6 GymATWAAac |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.