Transcription Factor

Accessions: T061915_1.02 (CISBP 1.02)
Names: T061915_1.02;, ZFA5
Organisms: PBM CONSTRUCTS
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 92
Pfam Domains: 8-32 C2H2-type zinc finger
8-32 Zinc finger, C2H2 type
24-51 Zinc-finger double domain
38-62 Zinc finger, C2H2 type
40-62 C2H2-type zinc finger
54-77 Zinc-finger double domain
68-90 Zinc finger, C2H2 type
68-90 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 SRPGEKPHICHIQGCGKVYGQSSHLTRHLRWHTGERPFMCTWSYCGKRFTRSDDLQRHKR 60
61 THTGEKKFACPECPKRFMQSGHLQRHIKTHTG
Interface Residues: 20, 21, 22, 23, 24, 26, 27, 29, 30, 33, 49, 50, 51, 52, 53, 54, 56, 57, 58, 60, 62, 63, 78, 79, 80, 81, 82, 83, 84, 85, 86
3D-footprint Homologues: 7n5w_A, 6jnm_A, 6ml4_A, 5v3j_F, 1tf3_A, 5ei9_F, 1g2f_F, 5kl3_A, 1ubd_C, 2kmk_A, 1llm_D, 7ysf_A, 2drp_D, 8ssq_A, 7w1m_H, 6blw_A, 6u9q_A, 5yel_A, 4x9j_A, 2gli_A, 8ssu_A, 6e94_A, 5kkq_D, 1tf6_A, 8gn3_A, 8h9h_G, 7y3m_I, 2lt7_A, 6a57_A, 2jpa_A, 5h9f_G, 3uk3_C, 8cuc_F, 7y3l_A, 7txc_E, 5k5i_A, 1f2i_J, 2wbs_A, 4m9v_C, 5yj3_D
Binding Motifs: M0565_1.02 GwGCGGGw
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.